Comparing WP_055435226.1 NCBI__GCF_001418085.1:WP_055435226.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
1wa3D Mechanism of the class i kdpg aldolase (see paper)
37% identity, 83% coverage: 11:194/222 of query aligns to 4:182/203 of 1wa3D
2v82A Kdpgal complexed to kdpgal (see paper)
31% identity, 67% coverage: 73:221/222 of query aligns to 60:200/205 of 2v82A
Sites not aligning to the query:
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal aldolase; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
31% identity, 67% coverage: 73:221/222 of query aligns to 61:201/205 of Q6BF16
Sites not aligning to the query:
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
28% identity, 85% coverage: 27:215/222 of query aligns to 26:209/213 of 1euaA
P0A955 KHG/KDPG aldolase; (4S)-4-hydroxy-2-oxoglutarate aldolase; 2-dehydro-3-deoxy-phosphogluconate aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG aldolase; 2-keto-4-hydroxyglutarate aldolase; KHG aldolase; Ketohydroxyglutarate aldolase; Entner-Douderoff aldolase; Oxaloacetate decarboxylase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.3.42; EC 4.1.2.14; EC 4.1.1.112 from Escherichia coli (strain K12) (see 5 papers)
28% identity, 85% coverage: 27:215/222 of query aligns to 26:209/213 of P0A955
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
28% identity, 93% coverage: 8:213/222 of query aligns to 4:200/209 of 5xsfA
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
29% identity, 97% coverage: 3:217/222 of query aligns to 6:213/216 of 1mxsA
1wauA Structure of kdpg aldolase e45n mutant (see paper)
28% identity, 85% coverage: 27:215/222 of query aligns to 26:209/213 of 1wauA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
28% identity, 85% coverage: 27:215/222 of query aligns to 27:210/214 of 2c0aB
Sites not aligning to the query:
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
29% identity, 91% coverage: 18:218/222 of query aligns to 14:212/216 of 3vcrA
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
26% identity, 89% coverage: 12:209/222 of query aligns to 8:200/210 of 6oviA
>WP_055435226.1 NCBI__GCF_001418085.1:WP_055435226.1
MAKYSRIEVANVMQETGLVPLFYDSDIDNCKQVLKACYAGGARLMEFTARGDFAHEIFGA
LNTYALKELPGMILGVGSVTDAASASLYMALGANFIVTPVFREDIAIVCNRRKVLWSPGC
GSLTEIARAEELGCEIVKLFPGGIYGPDFIKAIKGPQPWTSIMPTGGVSPTKENLEGWFS
AGVTCVGIGSKLIKKNTEGKFDFSAIESLTNEAIEIIKDLRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory