Comparing WP_055436331.1 NCBI__GCF_001418085.1:WP_055436331.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1u08A Crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. (see paper)
48% identity, 99% coverage: 5:380/380 of query aligns to 6:382/382 of 1u08A
2o0rA The three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis (see paper)
32% identity, 97% coverage: 4:373/380 of query aligns to 3:376/385 of 2o0rA
Q17CS8 Kynurenine aminotransferase; AeKAT; EC 2.6.1.-; EC 2.6.1.63; EC 2.6.1.7 from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see 2 papers)
36% identity, 94% coverage: 21:378/380 of query aligns to 81:471/477 of Q17CS8
Sites not aligning to the query:
1yiyA Aedes aegypti kynurenine aminotransferase (see paper)
35% identity, 94% coverage: 21:378/380 of query aligns to 22:412/418 of 1yiyA
2r5eA Aedes kynurenine aminotransferase in complex with glutamine (see paper)
35% identity, 94% coverage: 21:378/380 of query aligns to 23:413/419 of 2r5eA
Sites not aligning to the query:
2r5cB Aedes kynurenine aminotransferase in complex with cysteine (see paper)
35% identity, 94% coverage: 21:378/380 of query aligns to 23:413/419 of 2r5cB
Sites not aligning to the query:
4wljA High resolution crystal structure of human kynurenine aminotransferase-i in complex with aminooxyacetate (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 21:404/413 of 4wljA
Sites not aligning to the query:
1w7nA Crystal structure of human kynurenine aminotransferase i in pmp form (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 21:407/415 of 1w7nA
1w7mA Crystal structure of human kynurenine aminotransferase i in complex with l-phe (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 21:407/415 of 1w7mA
Sites not aligning to the query:
1w7lA Crystal structure of human kynurenine aminotransferase i (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 21:407/415 of 1w7lA
3fvuA Crystal structure of human kynurenine aminotransferase i in complex with indole-3-acetic acid (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 21:410/419 of 3fvuA
Sites not aligning to the query:
3fvsB Human kynurenine aminotransferase i in complex with glycerol (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 21:410/419 of 3fvsB
Sites not aligning to the query:
Q16773 Kynurenine--oxoglutarate transaminase 1; Cysteine-S-conjugate beta-lyase; Glutamine transaminase K; GTK; Glutamine--phenylpyruvate transaminase; Kynurenine aminotransferase 1; Kynurenine aminotransferase I; KATI; Kynurenine--oxoglutarate transaminase I; EC 2.6.1.7; EC 4.4.1.13; EC 2.6.1.64 from Homo sapiens (Human) (see paper)
31% identity, 93% coverage: 21:375/380 of query aligns to 24:413/422 of Q16773
5verA Mouse kynurenine aminotransferase iii, re-refinement of the PDB structure 3e2z (see paper)
32% identity, 98% coverage: 6:376/380 of query aligns to 4:405/410 of 5verA
Sites not aligning to the query:
5vepA Mouse kynurenine aminotransferase iii, re-refinement of the PDB structure 3e2f (see paper)
32% identity, 98% coverage: 6:376/380 of query aligns to 4:405/410 of 5vepA
Sites not aligning to the query:
3e2zA Crystal structure of mouse kynurenine aminotransferase iii in complex with kynurenine (see paper)
32% identity, 98% coverage: 6:376/380 of query aligns to 4:405/410 of 3e2zA
3e2yA Crystal structure of mouse kynurenine aminotransferase iii in complex with glutamine (see paper)
32% identity, 98% coverage: 6:376/380 of query aligns to 4:405/410 of 3e2yA
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
31% identity, 97% coverage: 13:380/380 of query aligns to 13:367/368 of 1v2fA
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
31% identity, 97% coverage: 13:380/380 of query aligns to 13:367/368 of 1v2eA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 94% coverage: 22:380/380 of query aligns to 22:381/388 of 1gdeA
>WP_055436331.1 NCBI__GCF_001418085.1:WP_055436331.1
MKHLSKLPNVGTTIFSVMSALANEHNAINMSQGFPNFKSDSKLIDLVSQAMNSGFNQYAP
MPGNMELREAIAKKMELLYNSTYNPETEITVTAGATQAIYTIISTFIRPNDEVIIFRPAY
DCYEPAIEINGGKTISIQLNAPHYKVNWEEVSTHFSSKTKMIIINTPQNPSGSVFTKADM
LALQKLTENTNCIVLSDEVYEHIIYDGLEHESACKFPGLKSRSFITASFGKTFHNTGWKV
GYCCAPKELMDEFKKVHQFNVFSVNHPTQKALADYLKEPNNYLGLSEFYQTKRDLFLSLI
KDSRFKYIPAKGTYFQVLDFSEITKENDVDFAKRLTINHGLAAIPLSVFNDNNKDDKVLR
FCFAKTDDTLKKAAEIINNI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory