Comparing WP_055436508.1 NCBI__GCF_001418085.1:WP_055436508.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
38% identity, 97% coverage: 5:289/294 of query aligns to 3:289/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
38% identity, 97% coverage: 5:289/294 of query aligns to 2:288/294 of Q9X1K9
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
40% identity, 97% coverage: 7:291/294 of query aligns to 4:287/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
40% identity, 97% coverage: 7:291/294 of query aligns to 4:287/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
40% identity, 97% coverage: 7:291/294 of query aligns to 4:287/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
40% identity, 97% coverage: 7:291/294 of query aligns to 4:287/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
40% identity, 97% coverage: 7:291/294 of query aligns to 4:287/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
40% identity, 97% coverage: 7:291/294 of query aligns to 4:287/291 of 3pueB
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
36% identity, 96% coverage: 11:293/294 of query aligns to 11:293/295 of 5ktlA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
38% identity, 97% coverage: 7:291/294 of query aligns to 4:287/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
38% identity, 97% coverage: 7:291/294 of query aligns to 4:287/292 of 3puoA
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
37% identity, 98% coverage: 5:291/294 of query aligns to 2:288/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
37% identity, 98% coverage: 5:291/294 of query aligns to 2:288/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
37% identity, 98% coverage: 5:291/294 of query aligns to 3:289/293 of 5t25A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
39% identity, 98% coverage: 5:291/294 of query aligns to 2:287/292 of Q07607
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
37% identity, 98% coverage: 5:291/294 of query aligns to 2:288/292 of 3i7sA
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
39% identity, 99% coverage: 2:292/294 of query aligns to 1:291/296 of 7kg2A
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
38% identity, 99% coverage: 2:292/294 of query aligns to 1:291/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
38% identity, 99% coverage: 2:292/294 of query aligns to 1:291/296 of 6u01B
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
39% identity, 94% coverage: 11:285/294 of query aligns to 13:286/307 of 4fhaA
>WP_055436508.1 NCBI__GCF_001418085.1:WP_055436508.1
MKNPFLGTGIAIVTPFKTNGSIDEEALANIVEFNIDNGTNYIVICGTTGESVTITKQEKL
DVIAIISKANKGRLPLVLGIGGNNTVEVVKEIEGTDLSQFAGILSVSPYYSKPTQEGIYQ
HFKAVSNACPVPIILYNVPGRTASNMSPETTLRLANDFENIVAVKEAGNNVAQYLNLLKD
KPEGFGVISGDDDLALSVALAGGDGVISVIGQALPKAFSKMIALGRAGEAKEAYKIHFDL
MEITSLIFSENNPAGIKAVLQALELCNDTVRLPLVVATDELKEKIKNYLSNFNK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory