Comparing WP_057506685.1 NCBI__GCF_001431535.1:WP_057506685.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
34% identity, 96% coverage: 10:342/346 of query aligns to 15:332/333 of 6b2wA
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
31% identity, 97% coverage: 5:340/346 of query aligns to 3:359/360 of 6nicD
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
31% identity, 97% coverage: 5:340/346 of query aligns to 13:373/374 of G7JT50
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
29% identity, 97% coverage: 7:340/346 of query aligns to 15:366/369 of 3h7cX
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 97% coverage: 7:340/346 of query aligns to 15:373/383 of Q8GWW7
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
28% identity, 97% coverage: 5:340/346 of query aligns to 15:364/365 of Q837U5
4ytbA Crystal structure of porphyromonas gingivalis peptidylarginine deiminase (ppad) in complex with dipeptide asp-gln. (see paper)
22% identity, 97% coverage: 5:338/346 of query aligns to 12:313/422 of 4ytbA
4ytgA Crystal structure of porphyromonas gingivalis peptidylarginine deiminase (ppad) mutant c351a in complex with dipeptide met-arg. (see paper)
22% identity, 91% coverage: 5:319/346 of query aligns to 12:292/417 of 4ytgA
Sites not aligning to the query:
>WP_057506685.1 NCBI__GCF_001431535.1:WP_057506685.1
MNQTLRFPAEWEAQSGVLIAWPTADTDWADRLGQVEETYIALVAAITRFQPVLICVADDD
VETYAEMRLRSNRIDMQRVRFVTAAYDDTWLRDSGPITLQRKDGGFQLLDFRFTGWGGKF
DATLDDQLVGVLDAARVFNDAPVRSIAFALEGGGIETDGQGTLLTTWKCLHERHPDRDRA
SLSADLADWLQQDRVLWLDHGYLEGDDTDAHIDTLARFASADSIVYQACDDASDSHHAEL
QAMGAELAALRTADGQPYRLFPLPWPQPVLDEGRRLAASYANFLIVNGAVLMPAYGDAAD
EAARDVLAAAFPDREIVQVPCRSLIWQNGSLHCITMQLPAGLLANG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory