Comparing WP_057506693.1 NCBI__GCF_001431535.1:WP_057506693.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
55% identity, 94% coverage: 4:279/294 of query aligns to 4:278/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
56% identity, 92% coverage: 4:274/294 of query aligns to 2:267/282 of 5ve7A
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
51% identity, 96% coverage: 3:283/294 of query aligns to 3:280/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
49% identity, 90% coverage: 5:268/294 of query aligns to 8:271/281 of 8f73E
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
48% identity, 97% coverage: 5:289/294 of query aligns to 2:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
48% identity, 97% coverage: 5:289/294 of query aligns to 2:289/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
47% identity, 97% coverage: 5:289/294 of query aligns to 2:284/285 of 6ikzB
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
46% identity, 90% coverage: 5:268/294 of query aligns to 2:257/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
46% identity, 90% coverage: 5:268/294 of query aligns to 2:257/264 of 3jukD
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
44% identity, 96% coverage: 3:283/294 of query aligns to 3:247/255 of 2ux8A
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
42% identity, 97% coverage: 8:291/294 of query aligns to 5:289/291 of 8b6dA
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
41% identity, 99% coverage: 5:294/294 of query aligns to 3:294/299 of 2pa4B
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
40% identity, 97% coverage: 8:291/294 of query aligns to 5:284/286 of 8b68A
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
28% identity, 89% coverage: 7:268/294 of query aligns to 2:234/288 of 4ho6A
Sites not aligning to the query:
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
28% identity, 89% coverage: 7:268/294 of query aligns to 2:234/288 of 4ho5A
Sites not aligning to the query:
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
28% identity, 89% coverage: 7:268/294 of query aligns to 2:234/288 of 4ho3A
Sites not aligning to the query:
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
28% identity, 89% coverage: 7:268/294 of query aligns to 2:234/289 of 4ho4A
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
28% identity, 89% coverage: 7:268/294 of query aligns to 2:234/294 of 4ho9A
Sites not aligning to the query:
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
29% identity, 93% coverage: 6:277/294 of query aligns to 4:246/295 of 6n0uA
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
28% identity, 89% coverage: 7:268/294 of query aligns to 2:232/286 of 4hocA
>WP_057506693.1 NCBI__GCF_001431535.1:WP_057506693.1
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLIFITNR
YKHAVADYFDKAYELEQKLERAGKLEQLELVRHVLPNGVRAVFVTQAEALGLGHAVLCAK
EIIGDEPFAVLLPDDLIYNRGDSALKQMADLNEATGASVIAVEDVPHEQTASYGIVATEA
FDGSHGRISAIVEKPKPDDAPSDLAVVGRYVLSPKIFELLEATGTGAGGEIQLTDAIAEL
LKTEPVDAYRFQGRRFDCGTHLGLVEATIRFALNSKKLAKPARQKLQEMLAEED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory