SitesBLAST
Comparing WP_057506707.1 NCBI__GCF_001431535.1:WP_057506707.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
81% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 2ztlA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), L200 (= L200)
- binding (3s)-3-hydroxybutanoic acid: Q94 (= Q94), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), G15 (= G15), I16 (= I16), F36 (= F36), L64 (= L64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (= L113), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (= W187), V188 (= V188), T190 (= T190), V193 (= V193)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
81% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 1wmbA
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
75% identity, 100% coverage: 1:260/260 of query aligns to 1:236/236 of 1x1tA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding cacodylate ion: S142 (= S142), H144 (= H144), Y155 (= Y155), W187 (= W187), W233 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), G35 (= G35), F36 (= F36), D63 (= D63), L64 (= L64), N90 (= N90), G92 (= G92), L113 (= L113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (= W187), V188 (= V188), T190 (= T190)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
71% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 5b4tA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ L200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q94), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), G15 (= G15), I16 (= I16), F36 (= F36), D63 (= D63), L64 (= L64), N90 (= N90), G92 (= G92), L113 (= L113), I140 (= I140), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (= W187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
71% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 3w8dA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ L200)
- binding methylmalonic acid: Q94 (= Q94), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196), W257 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), F36 (= F36), A62 (= A62), D63 (= D63), L64 (= L64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (= L113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (= W187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
71% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 3vdrA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ L200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q94), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196), W257 (= W257)
- binding acetoacetic acid: Q94 (= Q94), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (= W187), Q196 (= Q196), W257 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), I16 (= I16), F36 (= F36), D63 (= D63), L64 (= L64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (= L113), K159 (= K159), G186 (= G186), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G11), T13 (= T13), I16 (= I16), F36 (= F36), D63 (= D63), L64 (= L64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (= L113), S142 (= S142), Y155 (= Y155), K159 (= K159), G186 (= G186), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
71% identity, 100% coverage: 1:260/260 of query aligns to 1:260/260 of 3vdqA
- active site: G15 (= G15), N114 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ L200)
- binding acetate ion: Q94 (= Q94), H144 (= H144), K152 (= K152), W187 (= W187), L192 (= L192), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), S14 (= S14), I16 (= I16), F36 (= F36), D63 (= D63), L64 (= L64), N90 (= N90), A91 (= A91), G92 (= G92), L113 (= L113), I140 (= I140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (= W187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
59% identity, 100% coverage: 2:260/260 of query aligns to 2:255/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), G35 (= G35), F36 (= F36), L60 (= L64), N86 (= N90), G88 (= G92), I89 (= I93), A137 (= A141), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), V184 (= V188), T186 (= T190)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
60% identity, 100% coverage: 2:260/260 of query aligns to 2:255/255 of 2q2qD
- active site: G15 (= G15), S138 (= S142), Y151 (= Y155), K155 (= K159), R196 (≠ L200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), F36 (= F36), D59 (= D63), L60 (= L64), N86 (= N90), G88 (= G92), L109 (= L113), I136 (= I140), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), W183 (= W187), V184 (= V188), T186 (= T190), L188 (= L192), V189 (= V193)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
40% identity, 100% coverage: 1:260/260 of query aligns to 3:260/260 of 6zzqA
- active site: G17 (= G15), S142 (= S142), Y155 (= Y155)
- binding acetoacetic acid: Q94 (= Q94), S142 (= S142), K152 (= K152), Y155 (= Y155), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), S16 (= S14), G17 (= G15), I18 (= I16), D37 (≠ G35), M38 (≠ F36), D63 (= D63), V64 (≠ L64), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ I140), A141 (= A141), S142 (= S142), Y155 (= Y155), K159 (= K159), Y187 (≠ W187), V188 (= V188), T190 (= T190)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
40% identity, 100% coverage: 1:260/260 of query aligns to 4:261/261 of 6zzsD
- active site: G18 (= G15), S143 (= S142), Y156 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G14 (= G11), S17 (= S14), I19 (= I16), D38 (≠ G35), M39 (≠ F36), D64 (= D63), V65 (≠ L64), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ I140), A142 (= A141), S143 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), V189 (= V188), T191 (= T190), L193 (= L192)
- binding 3-oxidanylidenepentanoic acid: Q95 (= Q94), S143 (= S142), N145 (≠ H144), K153 (= K152), Y156 (= Y155), Q197 (= Q196)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 98% coverage: 2:256/260 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G15), S142 (= S142), Q152 (≠ K152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ T13), R15 (≠ S14), G16 (= G15), I17 (= I16), N35 (= N34), Y36 (≠ G35), N37 (≠ F36), G38 (= G37), S39 (≠ D38), N63 (≠ D63), V64 (≠ L64), N90 (= N90), A91 (= A91), I93 (= I93), I113 (≠ L113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ V188), T190 (= T190)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 100% coverage: 1:259/260 of query aligns to 2:247/248 of 6ixmC
- active site: G16 (= G15), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), S15 (= S14), G16 (= G15), I17 (= I16), D36 (≠ G35), I37 (≠ F36), A61 (= A62), D62 (= D63), T63 (≠ L64), N89 (= N90), A90 (= A91), M140 (≠ I140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ G186), Y187 (≠ W187), I188 (≠ V188), L192 (= L192)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 97% coverage: 5:256/260 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G15), N111 (= N114), S139 (= S142), Q149 (≠ K152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ T96), K98 (≠ E101), S139 (= S142), N146 (≠ S149), V147 (= V150), Q149 (≠ K152), Y152 (= Y155), F184 (≠ W187), M189 (≠ L192), K200 (≠ R203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), N17 (≠ S14), G18 (= G15), I19 (= I16), D38 (≠ G35), F39 (= F36), V59 (= V57), D60 (= D63), V61 (≠ L64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (= I93), T137 (≠ I140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ W187), T185 (≠ V188), T187 (= T190), M189 (≠ L192)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 98% coverage: 5:260/260 of query aligns to 8:255/255 of 5itvA
- active site: G18 (= G15), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), S17 (= S14), G18 (= G15), I19 (= I16), D38 (≠ G35), I39 (≠ F36), T61 (≠ A62), I63 (≠ L64), N89 (= N90), G91 (= G92), T139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I186 (≠ W187), I187 (≠ V188)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
36% identity, 97% coverage: 6:256/260 of query aligns to 3:241/244 of 1edoA
- active site: G12 (= G15), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (≠ T13), R11 (≠ S14), I13 (= I16), N31 (= N34), Y32 (≠ G35), A33 (≠ F36), R34 (≠ G37), S35 (≠ D38), D59 (= D63), V60 (≠ L64), N86 (= N90), A87 (= A91), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (≠ V188), S186 (≠ T190), M188 (≠ L192)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
38% identity, 98% coverage: 5:259/260 of query aligns to 3:249/250 of 2cfcA
- active site: G13 (= G15), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ S149), R152 (≠ K152), Y155 (= Y155), W195 (≠ Q195), R196 (≠ Q196)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), S12 (= S14), G13 (= G15), N14 (≠ I16), D33 (≠ G35), L34 (≠ F36), A59 (≠ H59), D60 (= D60), V61 (≠ G61), N87 (= N90), A88 (= A91), G89 (= G92), I140 (= I140), P185 (= P185), G186 (= G186), M187 (≠ W187), I188 (≠ V188), T190 (= T190), P191 (≠ A191), M192 (≠ L192), T193 (≠ V193)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
38% identity, 98% coverage: 5:259/260 of query aligns to 3:249/250 of Q56840
- SGN 12:14 (≠ SGI 14:16) binding
- D33 (≠ G35) binding
- DV 60:61 (≠ DG 60:61) binding
- N87 (= N90) binding
- S142 (= S142) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ K152) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y155) mutation Y->E,F: Loss of activity.
- K159 (= K159) mutation to A: Loss of activity.
- R179 (≠ T179) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VRTAL 188:192) binding
- WR 195:196 (≠ QQ 195:196) binding
- R196 (≠ Q196) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ A212) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ K219) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3s55D Crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to NAD (see paper)
33% identity, 100% coverage: 2:260/260 of query aligns to 2:273/275 of 3s55D
- active site: G15 (= G15), S152 (= S142), Y165 (= Y155), K169 (= K159), G210 (vs. gap)
- binding calcium ion: D52 (= D52), E55 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), R14 (≠ S14), M16 (≠ I16), D35 (≠ G35), R36 (≠ F36), A48 (≠ G48), V72 (≠ A62), D73 (= D63), V74 (≠ L64), N100 (= N90), A101 (= A91), G102 (= G92), I103 (= I93), T123 (≠ L113), V150 (≠ I140), S152 (= S142), Y165 (= Y155), K169 (= K159), P195 (= P185), G196 (= G186), I198 (≠ V188), T200 (= T190), M202 (≠ L192), T203 (≠ V193)
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
37% identity, 98% coverage: 3:256/260 of query aligns to 3:255/259 of 1w4zA
- active site: G15 (= G15), N112 (= N114), S142 (= S142), Y155 (= Y155), K159 (= K159), Y200 (≠ I197)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), S14 (= S14), G15 (= G15), I16 (= I16), R36 (≠ F36), G37 (= G37), D61 (= D63), V62 (≠ L64), N88 (= N90), G90 (= G92), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), V188 (= V188), T190 (= T190)
Query Sequence
>WP_057506707.1 NCBI__GCF_001431535.1:WP_057506707.1
MFNGKVAVVTGSTSGIGLGIATALARQGADIVLNGFGDAQEIERIRAGLQADFGVRVAHD
GADLSRGEAVREMIAHAVAAMGRIDILVNNAGIQHTASIEEFPVEKWDAILALNLSAVFH
ATAAALPCMKQQGAGRIINIASVHGLVASVNKAAYVTAKHGVVGFTKATALETAGTGITA
NAICPGWVRTALVEQQITALAEREGTDQESAARALLAEKQPSLQFVTPEQLGEMVVFLAS
DAAAQMTGTALPMDGGWTAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory