SitesBLAST
Comparing WP_057506718.1 NCBI__GCF_001431535.1:WP_057506718.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
33% identity, 95% coverage: 13:260/260 of query aligns to 8:257/257 of 5fffA
- active site: K206 (≠ R203)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (= Y104), H158 (≠ A158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G23), T20 (≠ S25), G22 (= G27), I23 (= I28), R43 (= R48), C67 (≠ A72), D68 (= D73), V69 (≠ L74), N96 (= N100), I146 (≠ L146), Y161 (= Y161), K165 (= K165), P191 (= P191), A193 (≠ S193), I194 (= I194), T196 (≠ F196), G198 (vs. gap), T199 (vs. gap)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
33% identity, 95% coverage: 13:260/260 of query aligns to 8:257/257 of 5ff9B
- active site: K206 (≠ R203)
- binding 4-(2-aminoethyl)phenol: Y100 (= Y104), I155 (≠ R155), H158 (≠ A158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G23), T20 (≠ S25), K21 (= K26), I23 (= I28), S42 (≠ A47), R43 (= R48), C67 (≠ A72), D68 (= D73), V69 (≠ L74), N96 (= N100), I146 (≠ L146), S148 (= S148), Y161 (= Y161), K165 (= K165), P191 (= P191), A193 (≠ S193), I194 (= I194), T196 (≠ F196), G198 (vs. gap), T199 (vs. gap)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
33% identity, 95% coverage: 13:260/260 of query aligns to 8:257/257 of A0A1A9TAK5
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 95% coverage: 14:259/260 of query aligns to 6:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), S17 (= S25), R18 (≠ K26), I20 (= I28), T40 (≠ R48), N62 (≠ D73), V63 (≠ L74), N89 (= N100), A90 (= A101), I92 (≠ M106), V139 (≠ L146), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), I187 (= I194), T189 (vs. gap), M191 (≠ F196)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
34% identity, 95% coverage: 13:259/260 of query aligns to 5:243/243 of 4i08A
- active site: G19 (= G27), N113 (≠ D120), S141 (= S148), Q151 (≠ A158), Y154 (= Y161), K158 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), S17 (= S25), R18 (≠ K26), I20 (= I28), T40 (≠ R48), N62 (≠ D73), V63 (≠ L74), N89 (= N100), A90 (= A101), G140 (≠ S147), S141 (= S148), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), T189 (≠ F196)
8hsaA Brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-NAD+
39% identity, 85% coverage: 36:257/260 of query aligns to 27:247/248 of 8hsaA
- binding nicotinamide-adenine-dinucleotide: D38 (vs. gap), L39 (vs. gap), C63 (≠ T69), N64 (≠ H70), V65 (≠ A71), N91 (= N100), A92 (= A101), G93 (≠ T102), I140 (≠ L146), S141 (= S147), Y155 (= Y161), K159 (= K165), P185 (= P191), G186 (= G192)
Sites not aligning to the query:
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
35% identity, 94% coverage: 14:257/260 of query aligns to 9:251/255 of 1ahiA
- active site: G22 (= G27), S146 (= S148), M156 (≠ A158), Y159 (= Y161), K163 (= K165)
- binding glycochenodeoxycholic acid: S146 (= S148), A148 (= A150), N151 (≠ Q153), Y159 (= Y161), A196 (≠ G199), V200 (= V206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G23), A21 (≠ K26), G22 (= G27), I23 (= I28), D42 (≠ A47), I43 (≠ R48), D68 (= D73), I69 (≠ L74), N95 (= N100), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (= I194), T194 (≠ E197), A196 (≠ G199)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 94% coverage: 14:257/260 of query aligns to 9:251/255 of P0AET8
- I23 (= I28) binding
- DI 42:43 (≠ AR 47:48) binding
- DI 68:69 (≠ DL 73:74) binding
- N95 (= N100) binding
- G99 (≠ Y104) binding
- S146 (= S148) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ Q153) binding
- Y159 (= Y161) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K165) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- I-LT 192:194 (≠ IEFE 194:197) binding
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
35% identity, 94% coverage: 14:257/260 of query aligns to 9:251/253 of 1ahhA
- active site: G22 (= G27), S146 (= S148), M156 (≠ A158), Y159 (= Y161), K163 (= K165)
- binding nicotinamide-adenine-dinucleotide: G18 (= G23), A21 (≠ K26), D42 (≠ A47), I43 (≠ R48), C67 (≠ A72), D68 (= D73), I69 (≠ L74), N95 (= N100), G97 (≠ T102), T145 (≠ S147), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (= I194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 95% coverage: 13:258/260 of query aligns to 2:247/247 of 4jroC
- active site: G16 (= G27), S142 (= S148), Q152 (≠ A158), Y155 (= Y161), K159 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), S14 (= S25), R15 (≠ K26), G16 (= G27), I17 (= I28), N35 (≠ C46), Y36 (≠ A47), N37 (≠ R48), G38 (= G49), S39 (≠ Q50), N63 (≠ D73), V64 (≠ L74), N90 (= N100), A91 (= A101), I93 (vs. gap), I113 (≠ V119), S142 (= S148), Y155 (= Y161), K159 (= K165), P185 (= P191), I188 (= I194), T190 (≠ F196)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 93% coverage: 14:256/260 of query aligns to 3:236/240 of 2d1yA
- active site: G16 (= G27), S135 (= S148), N145 (≠ A158), Y148 (= Y161), K152 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G23), R15 (≠ K26), I17 (= I28), D36 (≠ A47), L37 (≠ R48), R38 (≠ G49), V55 (≠ A72), D56 (= D73), L57 (= L74), N83 (= N100), A84 (= A101), A85 (≠ T102), I86 (vs. gap), V133 (≠ L146), S135 (= S148), Y148 (= Y161), K152 (= K165), P178 (= P191), G179 (= G192), I181 (= I194), T183 (≠ F196), A185 (≠ D198), V186 (≠ G199)
3lf2A NADPH bound structure of the short chain oxidoreductase q9hya2 from pseudomonas aeruginosa pao1 containing an atypical catalytic center (see paper)
35% identity, 90% coverage: 21:255/260 of query aligns to 11:252/257 of 3lf2A
- active site: G17 (= G27), S144 (= S148), T157 (≠ Y161), R161 (≠ K165), A201 (≠ D207)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G23), S15 (= S25), A37 (= A47), R38 (= R48), D39 (≠ G49), R42 (≠ G52), D65 (= D73), V66 (≠ L74)
P50162 Tropinone reductase 1; Tropine dehydrogenase; Tropinone reductase I; TR-I; EC 1.1.1.206 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
31% identity, 93% coverage: 13:255/260 of query aligns to 18:266/273 of P50162
- 25:49 (vs. 20:44, 52% identical) binding
- S158 (= S148) binding
- Y171 (= Y161) active site, Proton acceptor
1ae1B Tropinone reductase-i complex with NADP (see paper)
31% identity, 93% coverage: 13:255/260 of query aligns to 3:251/258 of 1ae1B
- active site: G17 (= G27), S143 (= S148), V153 (≠ A158), Y156 (= Y161), K160 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G23), S15 (= S25), K16 (= K26), G17 (= G27), I18 (= I28), S37 (≠ A47), R38 (= R48), C62 (≠ A72), D63 (= D73), L64 (= L74), N91 (= N100), A92 (= A101), S143 (= S148), Y156 (= Y161), K160 (= K165), P186 (= P191), I189 (= I194), T191 (vs. gap), L193 (vs. gap), V194 (vs. gap)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
34% identity, 95% coverage: 13:259/260 of query aligns to 2:244/244 of 6t77A
- active site: G16 (= G27), S138 (= S148), Y151 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), S14 (= S25), R15 (≠ K26), T37 (≠ R48), L58 (≠ T69), N59 (≠ H70), V60 (≠ A71), A87 (= A101), G88 (vs. gap), I89 (vs. gap)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
33% identity, 93% coverage: 14:255/260 of query aligns to 14:256/261 of 5u9pB
- active site: G27 (= G27), S152 (= S148), Y165 (= Y161), K169 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G23), R26 (≠ K26), G27 (= G27), I28 (= I28), R48 (= R48), D73 (= D73), V74 (≠ L74), N100 (= N100), A101 (= A101), I150 (≠ L146), Y165 (= Y161), K169 (= K165), P195 (= P191), F198 (≠ I194), T200 (≠ F196), L202 (≠ W201), N203 (≠ D202)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 93% coverage: 14:255/260 of query aligns to 4:248/252 of 1vl8B
- active site: G17 (= G27), S143 (= S148), I154 (≠ A158), Y157 (= Y161), K161 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G23), R16 (≠ K26), G17 (= G27), L18 (≠ I28), S37 (≠ A47), R38 (= R48), C63 (≠ A72), D64 (= D73), V65 (≠ L74), A91 (≠ N100), A92 (= A101), G93 (≠ T102), I94 (≠ G103), V114 (= V119), I141 (≠ L146), S143 (= S148), Y157 (= Y161), K161 (= K165), P187 (= P191), G188 (= G192), Y190 (≠ D202), T192 (≠ R204), M194 (≠ V206), T195 (vs. gap)
6y4dA Crystal structure of a short-chain dehydrogenase/reductase (sdr) from zephyranthes treatiae in complex with NADP+ (see paper)
32% identity, 95% coverage: 13:260/260 of query aligns to 8:257/257 of 6y4dA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G23), T20 (≠ S25), K21 (= K26), I23 (= I28), R43 (= R48), C67 (≠ A72), D68 (= D73), I69 (≠ L74), N96 (vs. gap), G98 (≠ T102), V146 (≠ L146), S147 (= S147), S148 (= S148), Y161 (= Y161), K165 (= K165), G192 (= G192), I194 (= I194), T196 (≠ F196), S198 (≠ D198)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
34% identity, 92% coverage: 17:255/260 of query aligns to 5:240/244 of 6wprA
- active site: G16 (= G27), S138 (= S148), Y151 (= Y161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), S14 (= S25), R15 (≠ K26), T37 (≠ R48), L58 (≠ A72), D59 (= D73), V60 (≠ L74), N86 (= N100), A87 (= A101), G88 (= G105), I89 (≠ M106), I136 (≠ L146), Y151 (= Y161), K155 (= K165), P181 (= P191)
3tzcA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae (see paper)
33% identity, 93% coverage: 14:255/260 of query aligns to 6:222/224 of 3tzcA
Query Sequence
>WP_057506718.1 NCBI__GCF_001431535.1:WP_057506718.1
MDTGRTAAGHGATLAGRRVAIAGGSKGIGRCIALAFAGAGASVSVCARGQQGLAALARDA
QDQGTPLHTHAADLSGLEQIGGWLENAAEALGGIDVLVNNATGYGMADDEDGWAASLQVD
LMAAVRASRLALPWLRASTDACILNLSSIAAQQPRPGAAPYAAAKAALSHYTTSQALALA
QYRIRVNAIAPGSIEFEDGLWDRRRVDDPALYHGTLAKIPFGRFGRPEEIAHAALFLCSP
LAGWITGHVLNVDGGQVLMG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory