Comparing WP_057506743.1 NCBI__GCF_001431535.1:WP_057506743.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
38% identity, 98% coverage: 1:427/437 of query aligns to 1:424/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
38% identity, 94% coverage: 1:409/437 of query aligns to 2:440/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
34% identity, 88% coverage: 3:385/437 of query aligns to 7:452/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 93% coverage: 3:407/437 of query aligns to 7:484/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
34% identity, 99% coverage: 1:431/437 of query aligns to 5:494/496 of 8g1yA
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 76% coverage: 100:433/437 of query aligns to 199:521/526 of Q9S7B5
Sites not aligning to the query:
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
28% identity, 76% coverage: 100:431/437 of query aligns to 124:444/444 of 2c2bA
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
27% identity, 76% coverage: 100:433/437 of query aligns to 142:448/448 of 2c2gA
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
29% identity, 44% coverage: 63:254/437 of query aligns to 15:193/350 of 6nmxA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
29% identity, 44% coverage: 63:254/437 of query aligns to 13:191/345 of 6cgqB
Sites not aligning to the query:
>WP_057506743.1 NCBI__GCF_001431535.1:WP_057506743.1
MRFVSTRGQSPAVSLSAAIAAGLAPDGGLYVPEQLPAPRQWVATPSLAQTAAQVLAPFFD
GDPLADALPAICAEAFDFPVPLRALPRRGDHVLELFHGPTAAFKDVGARFLAATLARLRS
GASTPLAIVVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQAFR
VAGSFDDCQALVKQALGDAALQAAVPLSSANSISLGRLLPQMSYYAHAALQHEQGGRAAL
NLVVPTGNLGNAMAAILARAIGLPIGRIALATNANDVLPRYFAGADYQPAHSVATTANAM
DVGAPSNFERLRWLFNGDDAALRQAFTAEAVDDVAIRATIASAHAGSGDVFCPHTATAVT
VLNALRAKGSKGDWAVVATAHPAKFESVVEPLIGETVAVPLALDALLRRPAHAEPLAADY
AALRAVLQAGLPSPERR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory