Comparing WP_057506747.1 NCBI__GCF_001431535.1:WP_057506747.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1q1kA Structure of atp-phosphoribosyltransferase from e. Coli complexed with pr-atp (see paper)
43% identity, 96% coverage: 12:302/303 of query aligns to 2:287/288 of 1q1kA
1h3dA Structure of the e.Coli atp-phosphoribosyltransferase (see paper)
43% identity, 96% coverage: 12:302/303 of query aligns to 2:287/288 of 1h3dA
4yb7C Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
43% identity, 96% coverage: 12:302/303 of query aligns to 3:293/294 of 4yb7C
7dahC Adenosine triphosphate phosphoribosyltransferase from vibrio cholerae in complex with atp and prpp
42% identity, 96% coverage: 12:302/303 of query aligns to 3:287/288 of 7dahC
4yb7A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
42% identity, 96% coverage: 12:302/303 of query aligns to 3:295/296 of 4yb7A
4yb6A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
42% identity, 96% coverage: 12:302/303 of query aligns to 3:295/296 of 4yb6A
4yb6E Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
43% identity, 96% coverage: 12:302/303 of query aligns to 3:292/293 of 4yb6E
5ubgA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp (see paper)
47% identity, 73% coverage: 12:231/303 of query aligns to 3:222/222 of 5ubgA
5ubiA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp (see paper)
47% identity, 71% coverage: 12:227/303 of query aligns to 3:218/218 of 5ubiA
5ub9A Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni (see paper)
46% identity, 73% coverage: 12:231/303 of query aligns to 2:220/220 of 5ub9A
2vd3A The structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
32% identity, 95% coverage: 12:300/303 of query aligns to 4:286/289 of 2vd3A
1nh8A Atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine (see paper)
36% identity, 74% coverage: 13:237/303 of query aligns to 2:209/276 of 1nh8A
Sites not aligning to the query:
5u99A Transition state analysis of adenosine triphosphate phosphoribosyltransferase (see paper)
36% identity, 74% coverage: 13:237/303 of query aligns to 4:213/278 of 5u99A
5lhtA Atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine (see paper)
37% identity, 62% coverage: 13:201/303 of query aligns to 2:181/284 of 5lhtA
Sites not aligning to the query:
6fcyA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and adp
33% identity, 61% coverage: 13:196/303 of query aligns to 4:177/208 of 6fcyA
6fd9A Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with amp
33% identity, 61% coverage: 13:196/303 of query aligns to 4:177/209 of 6fd9A
6fcwA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with pratp
33% identity, 61% coverage: 13:196/303 of query aligns to 4:177/209 of 6fcwA
6fctA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and atp
33% identity, 61% coverage: 13:196/303 of query aligns to 4:177/209 of 6fctA
6fcaA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp
33% identity, 61% coverage: 13:196/303 of query aligns to 4:177/209 of 6fcaA
1z7mE Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis (see paper)
28% identity, 61% coverage: 13:196/303 of query aligns to 2:172/200 of 1z7mE
>WP_057506747.1 NCBI__GCF_001431535.1:WP_057506747.1
MSASQAAPARDRLRIAIQKNGRLAEPARNLLSACGLSWRESRDKLFCYGESLPVDLLLVR
DDDIPGLIADGVCDLGIVGRNELDEQGAARVQRGLKPAFQALRGLGFGACRLMLAVPEEW
DWQGPQQLAGTRIATSYPAILKDWLDARDIQAQVVELSGSVEIAPRLGTADLICDLVSSG
GTLRANQLKPVETLLDSEAVLAGAVIAPDDARGALLAMLLRRLDGVVQVQDRKLLMFRAE
PANVAALEKLLADAEPLVRLPADDGAPRLQTMCPGPLSWQRMEELERAGAQGLMVLSVER
SLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory