Comparing WP_057506749.1 NCBI__GCF_001431535.1:WP_057506749.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
43% identity, 96% coverage: 11:359/364 of query aligns to 7:351/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
43% identity, 96% coverage: 11:359/364 of query aligns to 7:351/354 of 1fg3A
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
43% identity, 98% coverage: 4:359/364 of query aligns to 3:351/353 of 7szpA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
43% identity, 89% coverage: 34:357/364 of query aligns to 16:335/335 of 1geyA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
34% identity, 89% coverage: 34:358/364 of query aligns to 35:357/360 of 8bj3A
Sites not aligning to the query:
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 92% coverage: 27:361/364 of query aligns to 15:335/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
30% identity, 92% coverage: 27:360/364 of query aligns to 16:335/335 of 2f8jA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 92% coverage: 27:360/364 of query aligns to 9:328/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 92% coverage: 27:360/364 of query aligns to 10:329/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
30% identity, 92% coverage: 27:360/364 of query aligns to 10:329/329 of 1h1cA
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
31% identity, 95% coverage: 12:356/364 of query aligns to 11:357/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
31% identity, 95% coverage: 12:356/364 of query aligns to 9:355/364 of 3cq6A
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
31% identity, 98% coverage: 8:362/364 of query aligns to 1:351/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
31% identity, 98% coverage: 8:362/364 of query aligns to 1:351/353 of 4r2nA
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
32% identity, 83% coverage: 54:356/364 of query aligns to 61:357/369 of 4r8dA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
28% identity, 86% coverage: 48:361/364 of query aligns to 40:349/354 of 3ly1D
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
33% identity, 59% coverage: 36:249/364 of query aligns to 36:253/369 of 4wbtA
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
30% identity, 83% coverage: 55:357/364 of query aligns to 52:350/358 of 1lc7A
Sites not aligning to the query:
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 83% coverage: 55:357/364 of query aligns to 55:353/364 of P97084
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
30% identity, 83% coverage: 55:357/364 of query aligns to 48:346/355 of 1lkcA
Sites not aligning to the query:
>WP_057506749.1 NCBI__GCF_001431535.1:WP_057506749.1
MSASVQDVLALLRPDLQSFAGYSSARSTALQGDVWLNANESAWANPADASGSSRRYPDPQ
PPALLQALAGLYGVSPQQLLVGRGSDEAIDLLVRAFCRPGVDAVLATPPVFGMYAVCARL
QGAPLLEVPLVDSPAGLQVDLDAVIATARGQGARLVFLCSPSNPAGSEISAADIARTAQA
LQGQAVVVVDEAYIEYSGQPSATALLAHYPNLAVLRTLSKAHALAAARVGSLIAAPEIIA
ALRRCQAPYPVPQPCAELAVAALQPAALAATRARIDDVVRERARLSDALAGVDGVRQVYP
SAGNYLLVRFDDAQGAFDALLAAGVVVRDQRAAPQLGDALRISIGSTDENQRVLAALSAW
RAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory