Comparing WP_057506767.1 NCBI__GCF_001431535.1:WP_057506767.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q8U8Z6 Imidazolonepropionase; Imidazolone-5-propanoate hydrolase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
57% identity, 98% coverage: 6:397/401 of query aligns to 18:415/419 of Q8U8Z6
2puzB Crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate (see paper)
57% identity, 98% coverage: 6:397/401 of query aligns to 4:401/404 of 2puzB
2gokA Crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution (see paper)
57% identity, 98% coverage: 6:397/401 of query aligns to 4:401/404 of 2gokA
2oofA The crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample
52% identity, 99% coverage: 1:397/401 of query aligns to 1:399/403 of 2oofA
2q09A Crystal structure of imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-dioxo-imidazolidin-4-yl)-propionic acid (see paper)
52% identity, 99% coverage: 2:397/401 of query aligns to 1:398/402 of 2q09A
A0KF84 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) (see paper)
51% identity, 99% coverage: 1:397/401 of query aligns to 6:406/411 of A0KF84
2bb0A Structure of imidazolonepropionase from bacillus subtilis (see paper)
40% identity, 99% coverage: 2:396/401 of query aligns to 2:407/413 of 2bb0A
P42084 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Bacillus subtilis (strain 168) (see paper)
40% identity, 99% coverage: 2:396/401 of query aligns to 4:409/421 of P42084
2g3fA Crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue (see paper)
40% identity, 99% coverage: 2:396/401 of query aligns to 3:408/414 of 2g3fA
2pajA Crystal structure of an amidohydrolase from an environmental sample of sargasso sea (see paper)
26% identity, 56% coverage: 155:377/401 of query aligns to 149:359/421 of 2pajA
Sites not aligning to the query:
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
25% identity, 89% coverage: 23:377/401 of query aligns to 21:367/428 of 3hpaA
4wgxA Crystal structure of molinate hydrolase (see paper)
33% identity, 29% coverage: 15:130/401 of query aligns to 13:134/465 of 4wgxA
4ub9A Structural and catalytic characterization of molinate hydrolase (see paper)
33% identity, 29% coverage: 15:130/401 of query aligns to 15:136/467 of 4ub9A
Sites not aligning to the query:
>WP_057506767.1 NCBI__GCF_001431535.1:WP_057506767.1
MHCDTLWTNVHLMTLQGDGLGVIADAELASLDGRIVHVGAAGSGAQLQPATRIDGEGRWI
SPGLIDCHTHLVYAGNRANEFEQRLQGVSYADIARAGGGIVSTVRATRAASHAELVRQSR
PRLLAMRAEGITTLEIKSGYGLALDDERKQLQVARQLGVDCNVHVVPTFLGAHAVPPGRQ
AQEYIDEVCKLMIPAIAAEGLAEAVDIFCEDIAFSTAQAAQVFEAARAHGLAVKIHAEQL
SNQHGAELAARHGALSADHIEHLDAAGIAAMAAAGTVAVLLPGAFYFTRDTTLPPIEALR
AAGVPLALATDSNPGTSPLTSPLLAMNMGATLFRLTVDECIAGFTRNAARALGRADRIGQ
LAVGMDADLAIWDIDAPADLVYRIGFNPLHARVVRGQPDPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory