Comparing WP_057506768.1 NCBI__GCF_001431535.1:WP_057506768.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4f0lB Crystal structure of amidohydrolase from brucella melitensis
54% identity, 98% coverage: 10:455/456 of query aligns to 5:448/449 of 4f0lB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
53% identity, 97% coverage: 9:451/456 of query aligns to 2:447/450 of 3mduA
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
53% identity, 97% coverage: 9:451/456 of query aligns to 3:448/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
53% identity, 97% coverage: 9:451/456 of query aligns to 2:447/451 of 4rdvB
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
28% identity, 53% coverage: 199:441/456 of query aligns to 176:418/437 of 4dykA
Sites not aligning to the query:
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
28% identity, 52% coverage: 203:441/456 of query aligns to 180:418/435 of 4gbdA
Sites not aligning to the query:
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
23% identity, 91% coverage: 24:436/456 of query aligns to 25:418/441 of 3lnpA
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
22% identity, 86% coverage: 51:441/456 of query aligns to 45:403/420 of Q58936
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
24% identity, 76% coverage: 51:398/456 of query aligns to 55:367/428 of 3hpaA
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
25% identity, 83% coverage: 53:429/456 of query aligns to 62:409/439 of 4dzhA
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
24% identity, 76% coverage: 51:398/456 of query aligns to 56:400/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
24% identity, 76% coverage: 51:398/456 of query aligns to 56:400/474 of P72156
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
24% identity, 75% coverage: 51:394/456 of query aligns to 56:372/434 of 4f0sA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
24% identity, 75% coverage: 51:394/456 of query aligns to 56:372/436 of 4f0rA
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
24% identity, 75% coverage: 51:394/456 of query aligns to 56:387/452 of 8is4A
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
23% identity, 76% coverage: 51:398/456 of query aligns to 56:400/474 of Q9EYU0
6sj2B Amidohydrolase, ahs with 3-haa (see paper)
28% identity, 51% coverage: 222:453/456 of query aligns to 248:481/503 of 6sj2B
Sites not aligning to the query:
6sj4A Amidohydrolase, ahs with substrate analog (see paper)
28% identity, 51% coverage: 222:453/456 of query aligns to 239:472/494 of 6sj4A
Sites not aligning to the query:
6sj3A Amidohydrolase, ahs with 3-hba (see paper)
28% identity, 51% coverage: 222:453/456 of query aligns to 239:472/494 of 6sj3A
Sites not aligning to the query:
2imrA Crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans
27% identity, 27% coverage: 203:325/456 of query aligns to 166:317/380 of 2imrA
Sites not aligning to the query:
>WP_057506768.1 NCBI__GCF_001431535.1:WP_057506768.1
MTDSLSPPAFHAARALLPQGWARDVRLTVDDGCIGEIHVGVPTQAGDQGVQILVPGVPNL
HSHAFQRGMAGLTEIGGGDGDSFWSWRELMYRFLARLVPEAVEAIAAQAYMEMLESGFTR
VGEFHYLHHDADGRPYADRAEMSARIAAAAAQTGIGLTLLPVFYAHADFGGAAPNPAQRR
LIHDVDGFAQLLDGARTALRVLPDAVLGIAPHSLRAVTGEELSALLPLNDGPVHIHIAEQ
LREVDACVGWSGLRPVRWLYENAAVDARWCLVHATHIDDDERARIVASHAVAGLCPITEA
NLGDGLFPMQAFAREGGRFGIGSDSNVLIDAAEELRLLEYGQRLSLRGRNVIAPDAQRSS
GRFLFDGAQHGGAQALGVLAGLQPGASADLLELDAGHPAMLARDGDALLDSWVFAARNGA
LRSAWRRGRQCVADGRHLQRDAITARFAQALRGVLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory