Comparing WP_057506775.1 NCBI__GCF_001431535.1:WP_057506775.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
31% identity, 90% coverage: 37:394/398 of query aligns to 2:376/386 of P0A9J8
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
36% identity, 66% coverage: 132:393/398 of query aligns to 5:274/306 of 3mwbA
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
36% identity, 66% coverage: 132:393/398 of query aligns to 5:271/303 of 3mwbB
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
32% identity, 68% coverage: 130:398/398 of query aligns to 4:278/278 of 2qmxA
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
26% identity, 67% coverage: 129:393/398 of query aligns to 8:276/282 of 6vh5D
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
27% identity, 61% coverage: 155:396/398 of query aligns to 28:272/278 of 7am0B
3luyA Putative chorismate mutase from bifidobacterium adolescentis
27% identity, 67% coverage: 129:394/398 of query aligns to 5:284/326 of 3luyA
7alzA Gqqa- a novel type of quorum quenching acylases (see paper)
34% identity, 25% coverage: 296:396/398 of query aligns to 85:188/194 of 7alzA
5j6fA Crystal structure of dah7ps-cm complex from geobacillus sp. With prephenate (see paper)
35% identity, 21% coverage: 43:126/398 of query aligns to 4:85/352 of 5j6fA
Sites not aligning to the query:
3nvtA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e (see paper)
33% identity, 21% coverage: 45:126/398 of query aligns to 1:75/345 of 3nvtA
Sites not aligning to the query:
P39912 Protein AroA(G); EC 2.5.1.54; EC 5.4.99.5 from Bacillus subtilis (strain 168) (see paper)
35% identity, 20% coverage: 46:126/398 of query aligns to 9:87/358 of P39912
Sites not aligning to the query:
5gmuB Crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with chlorogenic acid (see paper)
35% identity, 20% coverage: 46:126/398 of query aligns to 8:86/87 of 5gmuB
3tfcA 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e in complex with phosphoenolpyruvate (see paper)
32% identity, 20% coverage: 46:126/398 of query aligns to 1:74/343 of 3tfcA
Sites not aligning to the query:
>WP_057506775.1 NCBI__GCF_001431535.1:WP_057506775.1
MARKPAKPASPKAPAAAPKKASPKARASKPAKPETPASAPPVLADVRGKIDQIDRDIQSL
IAERARFAHQVGKAKGKLAAAVDYYRPEREAQVLRMVVDRNEGPLSDELLVHVYREIMSA
CLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSALGLPMASIEEVFQEVEAGNADFGVVPVE
NSGQGTIQITLDMFLTSNLKICGEAELRVQQYIMSRSGHLEDIERIYAHPQSFMQTSAWL
RANLPKAEKIPVSSNAEGARRARNADDAAAIGGENAGHVYNLKKVVTKPIQNDADNTTRF
LVIGRSLFPSSGHDRTSVLVLIHDKPGALFDVLSPFARHGISMNRIESRPSHHGKWEYGF
FIDLSGHIDDAPMQAALAELEGHAAQIKVLGSYPVAVP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory