Comparing WP_057506825.1 NCBI__GCF_001431535.1:WP_057506825.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dfdA Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
26% identity, 83% coverage: 12:194/220 of query aligns to 2:190/205 of 4dfdA
P0A8Y3 Alpha-D-glucose 1-phosphate phosphatase YihX; Alpha-D-glucose-1-P phosphatase; Alpha-D-glucose-1-phosphatase; Haloacid dehalogenase-like phosphatase 4; HAD4; EC 3.1.3.10 from Escherichia coli (strain K12)
30% identity, 46% coverage: 103:203/220 of query aligns to 89:190/199 of P0A8Y3
2b0cA The crystal structure of the putative phosphatase from escherichia coli
30% identity, 46% coverage: 103:203/220 of query aligns to 91:192/199 of 2b0cA
Sites not aligning to the query:
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
25% identity, 85% coverage: 17:203/220 of query aligns to 3:209/241 of 4knvA
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
24% identity, 83% coverage: 16:198/220 of query aligns to 7:190/226 of Q9HZ62
5am5A Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5am5A
Sites not aligning to the query:
5am4A Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5am4A
Sites not aligning to the query:
5am1A Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5am1A
Sites not aligning to the query:
5am0A Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5am0A
Sites not aligning to the query:
5alzA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5alzA
Sites not aligning to the query:
5alyA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5alyA
Sites not aligning to the query:
5alxA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5alxA
Sites not aligning to the query:
5alwA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5alwA
Sites not aligning to the query:
5aluA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5aluA
Sites not aligning to the query:
5altA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5altA
Sites not aligning to the query:
5alpA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5alpA
Sites not aligning to the query:
5aloA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5aloA
Sites not aligning to the query:
5alnA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5alnA
Sites not aligning to the query:
5almA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5almA
Sites not aligning to the query:
5allA Ligand complex structure of soluble epoxide hydrolase (see paper)
30% identity, 32% coverage: 141:210/220 of query aligns to 146:215/546 of 5allA
Sites not aligning to the query:
>WP_057506825.1 NCBI__GCF_001431535.1:WP_057506825.1
MPSSPPRALLPSAPPSSLIFDLGGVLIDWNPRYLYRTLFDDAAQMEHFLEHVCSPQWNAA
QDAGRSWEQAVDELAAEHPHQRELIAAYWLRWQETLGDALHGTVALLAELKAAGVALYAL
TNWSAQTFPIARERFGFLSAFDDILVSGEEGLAKPDPRIFERALQRFGVEPSATLFIDDA
AANVQAAMGQGIPSLLFRNADSLRASLHALGLPVAAQAPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory