SitesBLAST
Comparing WP_057507191.1 NCBI__GCF_001431535.1:WP_057507191.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rjiC Acetolactate synthase from bacillus subtilis bound to thdp - crystal form i (see paper)
34% identity, 98% coverage: 2:541/551 of query aligns to 2:545/555 of 4rjiC
- binding magnesium ion: D438 (= D434), D465 (= D461), T467 (≠ A463)
- binding thiamine diphosphate: P24 (= P24), E48 (= E48), P74 (= P74), S387 (≠ M383), H388 (≠ Y384), Q411 (≠ A407), G437 (= G433), D438 (= D434), G439 (= G435), G440 (= G436), T467 (≠ A463), Y468 (= Y464), D469 (≠ G465), M470 (= M466), V471 (≠ I467), Y534 (= Y530)
4rjkF Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
34% identity, 98% coverage: 2:541/551 of query aligns to 1:544/552 of 4rjkF
- binding magnesium ion: D437 (= D434), D464 (= D461), T466 (≠ A463)
- binding pyruvic acid: A25 (≠ E26), K26 (≠ E27)
- binding thiamine diphosphate: P23 (= P24), E47 (= E48), P73 (= P74), G385 (= G382), S386 (≠ M383), H387 (≠ Y384), Q410 (≠ A407), L412 (≠ M409), G436 (= G433), D437 (= D434), G438 (= G435), G439 (= G436), T466 (≠ A463), Y467 (= Y464), D468 (≠ G465), M469 (= M466), V470 (≠ I467), Y533 (= Y530)
4rjkG Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
34% identity, 98% coverage: 2:541/551 of query aligns to 1:544/553 of 4rjkG
- binding magnesium ion: D437 (= D434), D464 (= D461), T466 (≠ A463)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: E47 (= E48), Q110 (= Q111)
- binding thiamine diphosphate: I384 (≠ N381), G385 (= G382), S386 (≠ M383), H387 (≠ Y384), Q410 (≠ A407), L412 (≠ M409), G436 (= G433), D437 (= D434), G438 (= G435), G439 (= G436), T466 (≠ A463), Y467 (= Y464), D468 (≠ G465), M469 (= M466), V470 (≠ I467), Y533 (= Y530)
1ozgA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate (see paper)
36% identity, 96% coverage: 4:533/551 of query aligns to 8:541/549 of 1ozgA
- active site: I27 (≠ V23), G29 (= G25), A30 (≠ E26), K31 (≠ E27), I32 (≠ N28), E52 (= E48), T75 (= T71), H114 (≠ F110), Q115 (= Q111), S116 (≠ I112), Q164 (≠ E160), L257 (= L252), E284 (≠ P279), M389 (≠ N381), Q415 (≠ A407), M417 (= M409), D442 (= D434), D469 (= D461), G471 (≠ A463), Y472 (= Y464), M474 (= M466), V475 (≠ I467), Q478 (≠ K470), Y538 (= Y530)
- binding 2-hydroxyethyl dihydrothiachrome diphosphate: M389 (≠ N381), G390 (= G382), S391 (≠ M383), F392 (≠ Y384), Q415 (≠ A407), M417 (= M409), G441 (= G433), D442 (= D434), G443 (= G435), D469 (= D461), G471 (≠ A463), Y472 (= Y464), N473 (≠ G465), M474 (= M466), V475 (≠ I467), Y538 (= Y530)
- binding magnesium ion: D442 (= D434), D469 (= D461), G471 (≠ A463)
- binding phosphate ion: G253 (= G248), R254 (≠ T249), Q261 (≠ D256), R347 (= R340), R398 (= R390), Y401 (≠ R393)
5dx6B Acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
35% identity, 96% coverage: 4:533/551 of query aligns to 19:544/557 of 5dx6B
- active site: I38 (≠ V23), G40 (= G25), A41 (≠ E26), K42 (≠ E27), I43 (≠ N28), E63 (= E48), T86 (= T71), H125 (≠ F110), Q126 (= Q111), S127 (≠ I112), Q175 (≠ E160), L268 (= L252), E295 (≠ P279), M392 (≠ N381), Q418 (≠ A407), M420 (= M409), D445 (= D434), D472 (= D461), G474 (≠ A463), Y475 (= Y464), M477 (= M466), V478 (≠ I467), Q481 (≠ K470), Y541 (= Y530)
- binding 3-fluoro-2-oxopropanoic acid: G264 (= G248), R265 (≠ T249), Q272 (≠ D256), A400 (= A389), R401 (= R390), Y404 (≠ R393)
- binding magnesium ion: S135 (≠ K120), T138 (= T123), D445 (= D434), D472 (= D461), G474 (≠ A463)
- binding thiamine diphosphate: G393 (= G382), S394 (≠ M383), F395 (≠ Y384), Q418 (≠ A407), M420 (= M409), G444 (= G433), D445 (= D434), G446 (= G435), D472 (= D461), G474 (≠ A463), Y475 (= Y464), N476 (≠ G465), M477 (= M466), V478 (≠ I467), Y541 (= Y530)
1ozfA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors (see paper)
36% identity, 96% coverage: 4:533/551 of query aligns to 7:537/545 of 1ozfA
- active site: I26 (≠ V23), G28 (= G25), A29 (≠ E26), K30 (≠ E27), I31 (≠ N28), E51 (= E48), T74 (= T71), H113 (≠ F110), Q114 (= Q111), S115 (≠ I112), Q163 (≠ E160), L253 (= L252), E280 (≠ P279), M385 (≠ N381), Q411 (≠ A407), M413 (= M409), D438 (= D434), D465 (= D461), G467 (≠ A463), Y468 (= Y464), M470 (= M466), V471 (≠ I467), Q474 (≠ K470), Y534 (= Y530)
- binding magnesium ion: D438 (= D434), D465 (= D461), G467 (≠ A463)
- binding phosphate ion: G249 (= G248), R250 (≠ T249), Q257 (≠ D256), R343 (= R340), R394 (= R390), L396 (≠ Y392), Y397 (≠ R393)
- binding thiamine diphosphate: G386 (= G382), S387 (≠ M383), F388 (≠ Y384), Q411 (≠ A407), M413 (= M409), G437 (= G433), D438 (= D434), G439 (= G435), D465 (= D461), G467 (≠ A463), Y468 (= Y464), N469 (≠ G465), M470 (= M466), V471 (≠ I467), Y534 (= Y530)
5d6rB Acetolactate synthase from klebsiella pneumoniae in complex with mechanism-based inhibitor
36% identity, 96% coverage: 4:533/551 of query aligns to 7:538/548 of 5d6rB
- active site: I26 (≠ V23), G28 (= G25), A29 (≠ E26), K30 (≠ E27), I31 (≠ N28), E51 (= E48), T74 (= T71), H113 (≠ F110), Q114 (= Q111), S115 (≠ I112), Q163 (≠ E160), L254 (= L252), E281 (≠ P279), M386 (≠ N381), Q412 (≠ A407), M414 (= M409), D439 (= D434), D466 (= D461), G468 (≠ A463), Y469 (= Y464), M471 (= M466), V472 (≠ I467), Q475 (≠ K470), Y535 (= Y530)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(Z)-2-fluoro-1-hydroxy-2-phosphonoethenyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M386 (≠ N381), G387 (= G382), S388 (≠ M383), Q412 (≠ A407), M414 (= M409), D439 (= D434), G440 (= G435), G468 (≠ A463), Y469 (= Y464), N470 (≠ G465), M471 (= M466), Y535 (= Y530)
- binding magnesium ion: R63 (= R60), Q212 (≠ R211), D439 (= D434), D466 (= D461), G468 (≠ A463)
5dx6A Acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
35% identity, 96% coverage: 4:533/551 of query aligns to 8:533/541 of 5dx6A
- active site: I27 (≠ V23), G29 (= G25), A30 (≠ E26), K31 (≠ E27), I32 (≠ N28), E52 (= E48), T75 (= T71), Q159 (≠ E160), L249 (= L252), E276 (≠ P279), M381 (≠ N381), Q407 (≠ A407), M409 (= M409), D434 (= D434), D461 (= D461), G463 (≠ A463), Y464 (= Y464), M466 (= M466), V467 (≠ I467), Q470 (≠ K470), Y530 (= Y530)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1R)-2-fluoro-1-hydroxyethyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M381 (≠ N381), G382 (= G382), S383 (≠ M383), F384 (≠ Y384), Q407 (≠ A407), M409 (= M409), G433 (= G433), D434 (= D434), G435 (= G435), D461 (= D461), G463 (≠ A463), Y464 (= Y464), N465 (≠ G465), Y530 (= Y530)
- binding magnesium ion: S119 (≠ K120), T122 (= T123), D434 (= D434), D461 (= D461), G463 (≠ A463)
5wdgA Acetolactate synthase from klebsiella pneumoniae in complex with a reaction intermediate
35% identity, 96% coverage: 4:533/551 of query aligns to 8:530/538 of 5wdgA
- active site: I27 (≠ V23), G29 (= G25), A30 (≠ E26), K31 (≠ E27), I32 (≠ N28), E52 (= E48), T75 (= T71), Q157 (≠ E160), L246 (= L252), E273 (≠ P279), M378 (≠ N381), Q404 (≠ A407), M406 (= M409), D431 (= D434), D458 (= D461), G460 (≠ A463), Y461 (= Y464), M463 (= M466), V464 (≠ I467), Q467 (≠ K470), Y527 (= Y530)
- binding (2S,3S)-2,3-dihydroxy-3-[(7S,8R,9aS)-8-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2,7-dimethyl-5,7,8,10-tetrahydro-9aH-pyrimido[4,5-d][1,3]thiazolo[3,2-a]pyrimidin-9a-yl]-2-methylbutanoic acid: M378 (≠ N381), S380 (≠ M383), F381 (≠ Y384), Q404 (≠ A407), M406 (= M409), G430 (= G433), D431 (= D434), G432 (= G435), G433 (= G436), D458 (= D461), G460 (≠ A463), Y461 (= Y464), N462 (≠ G465), M463 (= M466), V464 (≠ I467), Y527 (= Y530)
- binding magnesium ion: R64 (= R60), S117 (≠ K120), T120 (= T123), Q204 (≠ R211), D431 (= D434), D458 (= D461), G460 (≠ A463)
- binding pyruvic acid: G94 (≠ A90), R147 (= R150)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
31% identity, 97% coverage: 2:533/551 of query aligns to 94:643/667 of P09342
- C161 (= C68) modified: Disulfide link with 307
- P194 (≠ A101) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ G209) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
31% identity, 97% coverage: 2:533/551 of query aligns to 91:640/664 of P09114
- P191 (≠ A101) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W469) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6vz8D Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
29% identity, 95% coverage: 2:526/551 of query aligns to 11:527/531 of 6vz8D
- active site: Y32 (≠ V23), G34 (= G25), G35 (≠ E26), A36 (≠ E27), S37 (≠ N28), E58 (= E48), T81 (= T71), F120 (= F110), Q121 (= Q111), E122 (≠ I112), K170 (≠ E160), M256 (≠ L252), V283 (≠ S285), V376 (≠ N381), G402 (≠ A407), M404 (= M409), D429 (= D434), N456 (≠ D461), H458 (≠ A463), L459 (≠ Y464), M461 (= M466), V462 (≠ I467), W465 (= W469)
- binding flavin-adenine dinucleotide: G214 (= G206), G215 (≠ A207), G216 (≠ A208), T236 (= T232), L237 (≠ Q233), L254 (≠ A250), H257 (≠ S253), R278 (≠ D274), R282 (≠ K284), V283 (≠ S285), I291 (≠ F296), G399 (≠ N404)
- binding magnesium ion: H458 (≠ A463), L459 (≠ Y464), G460 (= G465)
- binding thiamine diphosphate: E58 (= E48), P84 (= P74), V376 (≠ N381), G377 (= G382), Q378 (≠ M383), H379 (≠ Y384), G402 (≠ A407), M404 (= M409), G428 (= G433), D429 (= D434), G430 (= G435), S431 (≠ G436), L459 (≠ Y464), G460 (= G465), M461 (= M466), V462 (≠ I467)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ L252), R292 (≠ K278), W489 (= W469)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ N381), G401 (= G382), Q402 (≠ M383), H403 (≠ Y384), G426 (≠ A407), M428 (= M409), G452 (= G433), D453 (= D434), G454 (= G435), S455 (≠ G436), L483 (≠ Y464), G484 (= G465), M485 (= M466), V486 (≠ I467)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), M263 (≠ T249), L264 (≠ A250), M266 (≠ L252), H267 (≠ S253), G286 (= G272), R288 (≠ D274), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404)
- binding magnesium ion: A37 (≠ E27), T82 (= T71), S83 (≠ L72), Q122 (= Q111), Y381 (≠ R362), D453 (= D434), M458 (= M439), Q461 (= Q442), N480 (≠ D461), H482 (≠ A463), K533 (≠ V505)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ N381), G401 (= G382), Q402 (≠ M383), H403 (≠ Y384), G426 (≠ A407), M428 (= M409), G452 (= G433), D453 (= D434), G454 (= G435), S455 (≠ G436), M458 (= M439), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), G484 (= G465), M485 (= M466), V486 (≠ I467)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), L264 (≠ A250), M266 (≠ L252), H267 (≠ S253), G286 (= G272), V287 (≠ H273), R288 (≠ D274), D290 (≠ I276), R292 (≠ K278), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404)
- binding magnesium ion: F370 (vs. gap), D453 (= D434), M458 (= M439), Q461 (= Q442), N480 (≠ D461), H482 (≠ A463), K533 (≠ V505)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ L252), R292 (≠ K278), M485 (= M466), W489 (= W469)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 5wj1A
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ E27), S38 (≠ N28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (≠ I112), K171 (≠ E160), M266 (≠ L252), V293 (≠ P279), V400 (≠ N381), G426 (≠ A407), M428 (= M409), D453 (= D434), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), M485 (= M466), V486 (≠ I467), W489 (= W469), H558 (≠ Y530)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), M263 (≠ T249), L264 (≠ A250), G286 (= G272), R288 (≠ D274), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404), G424 (≠ A405)
- binding magnesium ion: D453 (= D434), N480 (≠ D461), H482 (≠ A463)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ L252), D291 (≠ E277), R292 (≠ K278), M485 (= M466), W489 (= W469)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ N381), G401 (= G382), Q402 (≠ M383), H403 (≠ Y384), M428 (= M409), D453 (= D434), G454 (= G435), S455 (≠ G436), M458 (= M439), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), G484 (= G465), M485 (= M466), V486 (≠ I467)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 5k6tA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ E27), S38 (≠ N28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (≠ I112), K171 (≠ E160), M266 (≠ L252), V293 (≠ P279), V400 (≠ N381), G426 (≠ A407), M428 (= M409), D453 (= D434), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), M485 (= M466), V486 (≠ I467), W489 (= W469), H558 (≠ Y530)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ S253), R292 (≠ K278), M485 (= M466), W489 (= W469)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), L264 (≠ A250), G286 (= G272), R288 (≠ D274), D290 (≠ I276), R292 (≠ K278), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), D329 (= D314), V330 (≠ I315), Q404 (≠ K385), M405 (≠ I386), G423 (≠ N404)
- binding magnesium ion: D453 (= D434), N480 (≠ D461), H482 (≠ A463)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ N381), G401 (= G382), Q402 (≠ M383), H403 (≠ Y384), G426 (≠ A407), M428 (= M409), G452 (= G433), G454 (= G435), S455 (≠ G436), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), G484 (= G465)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 5k6rA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ E27), S38 (≠ N28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (≠ I112), K171 (≠ E160), M266 (≠ L252), V293 (≠ P279), V400 (≠ N381), G426 (≠ A407), M428 (= M409), D453 (= D434), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), M485 (= M466), V486 (≠ I467), W489 (= W469), H558 (≠ Y530)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ K278), W489 (= W469)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), L264 (≠ A250), M266 (≠ L252), G286 (= G272), R288 (≠ D274), R292 (≠ K278), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), G328 (= G313), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404)
- binding magnesium ion: D453 (= D434), N480 (≠ D461), H482 (≠ A463)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ N381), G401 (= G382), Q402 (≠ M383), H403 (≠ Y384), G426 (≠ A407), M428 (= M409), D453 (= D434), G454 (= G435), S455 (≠ G436), M458 (= M439), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), G484 (= G465), M485 (= M466), V486 (≠ I467)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 1z8nA
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ E27), S38 (≠ N28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (≠ I112), K171 (≠ E160), M266 (≠ L252), V293 (≠ P279), V400 (≠ N381), G426 (≠ A407), M428 (= M409), D453 (= D434), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), M485 (= M466), V486 (≠ I467), W489 (= W469), H558 (≠ Y530)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K124), R161 (= R150), Y191 (≠ H176), R194 (≠ E179), D291 (≠ E277), R292 (≠ K278), D312 (≠ Q297), W489 (= W469)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), L264 (≠ A250), G265 (≠ A251), M266 (≠ L252), H267 (≠ S253), G286 (= G272), V287 (≠ H273), R288 (≠ D274), D290 (≠ I276), R292 (≠ K278), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404), G424 (≠ A405)
- binding magnesium ion: D453 (= D434), N480 (≠ D461)
- binding thiamine diphosphate: V400 (≠ N381), G401 (= G382), Q402 (≠ M383), H403 (≠ Y384), G426 (≠ A407), M428 (= M409), G452 (= G433), G454 (= G435), S455 (≠ G436), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), G484 (= G465), M485 (= M466), V486 (≠ I467)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 1yi1A
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ E27), S38 (≠ N28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (≠ I112), K171 (≠ E160), M266 (≠ L252), V293 (≠ P279), V400 (≠ N381), G426 (≠ A407), M428 (= M409), D453 (= D434), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), M485 (= M466), V486 (≠ I467), W489 (= W469), H558 (≠ Y530)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ E277), R292 (≠ K278), W489 (= W469)
- binding flavin-adenine dinucleotide: R161 (= R150), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), M263 (≠ T249), L264 (≠ A250), G265 (≠ A251), M266 (≠ L252), H267 (≠ S253), G286 (= G272), V287 (≠ H273), R288 (≠ D274), D290 (≠ I276), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404), G424 (≠ A405)
- binding magnesium ion: D453 (= D434), N480 (≠ D461), H482 (≠ A463)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
28% identity, 97% coverage: 2:533/551 of query aligns to 12:561/582 of 1yi0A
- active site: Y33 (≠ V23), G35 (= G25), G36 (≠ E26), A37 (≠ E27), S38 (≠ N28), E59 (= E48), T82 (= T71), F121 (= F110), Q122 (= Q111), E123 (≠ I112), K171 (≠ E160), M266 (≠ L252), V293 (≠ P279), V400 (≠ N381), G426 (≠ A407), M428 (= M409), D453 (= D434), N480 (≠ D461), H482 (≠ A463), L483 (≠ Y464), M485 (= M466), V486 (≠ I467), W489 (= W469), H558 (≠ Y530)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ E277), R292 (≠ K278), W489 (= W469)
- binding flavin-adenine dinucleotide: R161 (= R150), G222 (= G206), G223 (≠ A207), G224 (≠ A208), T246 (= T232), L247 (≠ Q233), M248 (= M234), L264 (≠ A250), G265 (≠ A251), M266 (≠ L252), H267 (≠ S253), G286 (= G272), V287 (≠ H273), R288 (≠ D274), D290 (≠ I276), R292 (≠ K278), V293 (≠ P279), D310 (≠ S295), I311 (≠ F296), G328 (= G313), D329 (= D314), V330 (≠ I315), M405 (≠ I386), G423 (≠ N404), G424 (≠ A405)
- binding magnesium ion: D453 (= D434), N480 (≠ D461), H482 (≠ A463)
Sites not aligning to the query:
Query Sequence
>WP_057507191.1 NCBI__GCF_001431535.1:WP_057507191.1
MQKGSDLLVKALENEGVDRIFGVPGEENLDFLESLRNSKIELVLTRHEQAAAFMAATHGR
LTGRPGVCLATLGPGALNFSTGAAYAHLGAWPMILITGQKAVMSAKQARFQIVDIVASMK
PLTKMTRQIVSPASIPAMVRDAFRVAMEERPGPVHLELPEDIAGEEVEDVPVIPIHALER
PIAAPAALDRAEAAILAAKRPLVMIGAAGSRPWLTEALSAFVARTRLPFFNTQMGKGAVT
GGSNLYMGTAALSEGDYVHEAVARADLIIAIGHDTIEKPPFLMKSSGGPKVIHISFQSAT
VEQVYHPDIEVLGDIGASVEALAERLEGRLPADEGMTELRQKILARLNDRADEDRFPITP
QRIVHDVRQAVPDDGIVCLDNGMYKIWFARNYRTHVANTLLLDNALATMGAGLPSAMMAA
MLYPQRRVLAVCGDGGFMMNSQELETAVRLGLNLVVVILNDSAYGMIRWKQAVDGFEDFG
MRFGNPDFVKYAEAYGAKGSRVSAVEELVPMIEAAFAGGGVHVLDVPIDYSENTRVLVDE
LRNRTPDVGCA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory