SitesBLAST
Comparing WP_057507196.1 NCBI__GCF_001431535.1:WP_057507196.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
52% identity, 99% coverage: 3:247/248 of query aligns to 3:239/244 of 1nfqA
- active site: G17 (= G17), S139 (= S140), Y152 (= Y155), K156 (= K159)
- binding Androsterone: L91 (= L91), E141 (≠ A142), C149 (≠ S152), Y152 (= Y155), V193 (≠ N200), I197 (≠ V205), F198 (≠ S206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ Q16), G17 (= G17), M18 (= M18), D37 (= D37), L39 (≠ N39), L59 (≠ Q59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), I137 (≠ V138), S139 (= S140), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (≠ I188), T187 (= T190), P188 (= P191), M189 (= M192), T190 (= T197)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
52% identity, 99% coverage: 3:247/248 of query aligns to 3:239/244 of 1nffA
- active site: G17 (= G17), S139 (= S140), Y152 (= Y155), K156 (= K159)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), R16 (≠ Q16), G17 (= G17), M18 (= M18), D37 (= D37), I38 (≠ V38), L39 (≠ N39), L59 (≠ Q59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (= I90), I137 (≠ V138), S139 (= S140), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (≠ I188), T187 (= T190), P188 (= P191), M189 (= M192), T190 (= T197)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
52% identity, 99% coverage: 3:247/248 of query aligns to 4:240/260 of P9WGT1
- I6 (≠ Q5) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ QGM 16:18) binding
- D38 (= D37) binding
- V47 (≠ L46) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 60:61) binding
- T69 (≠ Q68) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N87) binding
- S140 (= S140) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y155) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K159) binding
- 183:191 (vs. 185:197, 46% identical) binding
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
49% identity, 97% coverage: 4:244/248 of query aligns to 3:240/253 of 2hsdA
- active site: G16 (= G17), S138 (= S140), Y151 (= Y155), K155 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ Q16), G16 (= G17), L17 (≠ M18), D36 (= D37), V37 (= V38), L58 (≠ Q59), V60 (= V61), N86 (= N87), A87 (= A88), S138 (= S140), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), T184 (≠ I188)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
49% identity, 97% coverage: 4:244/248 of query aligns to 3:240/253 of 1hdcA
- active site: G16 (= G17), S138 (= S140), Y151 (= Y155), K155 (= K159)
- binding carbenoxolone: S90 (vs. gap), T91 (≠ L91), G92 (= G92), L147 (vs. gap), Y151 (= Y155), M183 (≠ F187), M188 (= M192), T189 (≠ M193), T192 (≠ G196)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
43% identity, 99% coverage: 3:248/248 of query aligns to 4:252/252 of Q6WVP7
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
43% identity, 99% coverage: 3:248/248 of query aligns to 3:251/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S140), I143 (= I141), Y155 (= Y155), F205 (≠ G201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ A15), L16 (≠ Q16), G17 (= G17), I18 (≠ M18), R38 (≠ V38), H39 (≠ N39), D62 (= D60), A63 (≠ V61), N89 (= N87), A90 (= A88), V112 (≠ I111), M140 (≠ V138), S142 (= S140), Y155 (= Y155), K159 (= K159), P187 (= P185), P189 (≠ F187), I190 (= I188), T192 (= T190), P193 (= P191), L194 (≠ M192)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
43% identity, 99% coverage: 3:248/248 of query aligns to 5:253/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S140), I145 (= I141), E146 (≠ A142), Y157 (= Y155), V197 (≠ M193), F207 (≠ G201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (≠ A15), I20 (≠ M18), R40 (≠ V38), H41 (≠ N39), D64 (= D60), A65 (≠ V61), N91 (= N87), A92 (= A88), V114 (≠ I111), M142 (≠ V138), S144 (= S140), Y157 (= Y155), K161 (= K159), P189 (= P185), G190 (= G186), P191 (≠ F187), I192 (= I188), T194 (= T190), P195 (= P191), L196 (≠ M192)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
41% identity, 100% coverage: 2:248/248 of query aligns to 2:251/251 of 1zk1A
- active site: G17 (= G17), S142 (= S140), Y155 (= Y155), K159 (= K159)
- binding 1-phenylethanone: A93 (≠ P93), N95 (≠ A95), Y155 (= Y155), Y189 (≠ F187)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ Q16), I18 (≠ M18), D37 (= D37), H61 (≠ Q59), D62 (= D60), S63 (≠ V61), N89 (= N87), A90 (= A88), I92 (= I90), M140 (≠ V138), Y155 (= Y155), G188 (= G186), I190 (= I188), L194 (≠ M192)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
41% identity, 100% coverage: 2:248/248 of query aligns to 2:251/251 of 1zjzA
- active site: G17 (= G17), S142 (= S140), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ Q16), I18 (≠ M18), D37 (= D37), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (= I90), Y155 (= Y155), G188 (= G186), I190 (= I188), L194 (≠ M192)
- binding (1r)-1-phenylethanol: A93 (≠ P93), N95 (≠ A95), L152 (= L153), Y155 (= Y155)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
41% identity, 100% coverage: 2:248/248 of query aligns to 2:251/251 of 1zjyA
- active site: G17 (= G17), S142 (= S140), Y155 (= Y155), K159 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G13), L16 (≠ Q16), G17 (= G17), I18 (≠ M18), D37 (= D37), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (= I90), Y155 (= Y155), G188 (= G186), I190 (= I188), L194 (≠ M192)
- binding (1r)-1-phenylethanol: A93 (≠ P93), N95 (≠ A95), L152 (= L153), Y155 (= Y155), Y189 (≠ F187)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 99% coverage: 4:248/248 of query aligns to 3:248/248 of 4urfB
- active site: G16 (= G17), S142 (= S140), I152 (≠ F150), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L210), R211 (≠ G211), R212 (= R212)
- binding bicarbonate ion: I92 (= I90), G94 (= G92), R109 (≠ K107), R179 (= R179), S228 (= S228)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ A15), N15 (≠ Q16), G16 (= G17), I17 (≠ M18), D36 (= D37), I37 (≠ V38), D62 (= D60), T63 (≠ V61), N89 (= N87), A90 (= A88), G91 (= G89), I140 (≠ V138), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ G186), I188 (= I188), T190 (= T190)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 99% coverage: 4:248/248 of query aligns to 3:248/248 of 4urfA
- active site: G16 (= G17), S142 (= S140), I152 (≠ F150), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I90), S93 (≠ L91), G94 (= G92), E95 (≠ P93), T97 (≠ A95), E101 (≠ D99), T103 (≠ S101), Q106 (≠ D104), R109 (≠ K107), S175 (≠ A175), G177 (≠ N177)
- binding magnesium ion: S237 (≠ H237), Y238 (≠ E238)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ A15), N15 (≠ Q16), G16 (= G17), I17 (≠ M18), D36 (= D37), I37 (≠ V38), W41 (≠ G42), D62 (= D60), T63 (≠ V61), N89 (= N87), A90 (= A88), G91 (= G89), I140 (≠ V138), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (= I188), T190 (= T190)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 99% coverage: 4:248/248 of query aligns to 3:248/248 of 4ureB
- active site: G16 (= G17), S142 (= S140), I152 (≠ F150), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ Q16), G16 (= G17), I17 (≠ M18), N89 (= N87), G91 (= G89), Y155 (= Y155), P185 (= P185), A186 (≠ G186)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
41% identity, 100% coverage: 2:248/248 of query aligns to 2:251/251 of 6y0sAAA
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
41% identity, 100% coverage: 2:248/248 of query aligns to 2:251/251 of 1zk4A
- active site: G17 (= G17), S142 (= S140), Y155 (= Y155), K159 (= K159)
- binding 1-phenylethanone: A93 (≠ P93), Y155 (= Y155), Y189 (≠ F187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ A15), L16 (≠ Q16), I18 (≠ M18), T36 (= T36), G37 (≠ D37), R38 (≠ V38), H61 (≠ Q59), D62 (= D60), N89 (= N87), A90 (= A88), G91 (= G89), I92 (= I90), Y155 (= Y155), G188 (= G186), I190 (= I188), T192 (= T190), L194 (≠ M192)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 98% coverage: 4:247/248 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G17), S142 (= S140), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ Q16), G16 (= G17), I17 (≠ M18), D36 (= D37), I37 (≠ V38), A61 (≠ Q59), D62 (= D60), T63 (≠ V61), N89 (= N87), A90 (= A88), M140 (≠ V138), S142 (= S140), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ G186), Y187 (≠ F187), I188 (= I188), L192 (≠ M192)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
40% identity, 98% coverage: 4:246/248 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G17), S140 (= S140), Y155 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (vs. gap), G18 (= G17), I19 (≠ M18), D38 (= D37), L39 (≠ V38), A60 (≠ Q59), N61 (≠ D60), V62 (= V61), N88 (= N87), V111 (≠ I111), S140 (= S140), Y155 (= Y155), K159 (= K159), I188 (= I188), T190 (= T190)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 99% coverage: 1:246/248 of query aligns to 2:243/244 of 4nbuB
- active site: G18 (= G17), N111 (= N112), S139 (= S140), Q149 (≠ S152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ P93), K98 (≠ D99), S139 (= S140), N146 (= N147), V147 (≠ Y148), Q149 (≠ S152), Y152 (= Y155), F184 (= F187), M189 (= M192), K200 (≠ E203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ Q16), G18 (= G17), I19 (≠ M18), D38 (= D37), F39 (≠ V38), V59 (≠ Q59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (= I90), T137 (≠ V138), S139 (= S140), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (= F187), T185 (≠ I188), T187 (= T190), M189 (= M192)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 99% coverage: 3:248/248 of query aligns to 4:255/255 of 5itvA
- active site: G18 (= G17), S141 (= S140), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ Q16), G18 (= G17), I19 (≠ M18), D38 (= D37), I39 (≠ V38), T61 (≠ Q59), I63 (≠ V61), N89 (= N87), G91 (= G89), T139 (≠ V138), S141 (= S140), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I186 (≠ F187), I187 (= I188)
Query Sequence
>WP_057507196.1 NCBI__GCF_001431535.1:WP_057507196.1
MSRLQGKVAIVTGAAQGMGASHVRNFVAEGAKVVFTDVNAEGGRALASELGDDVRFVQQD
VTSWDAWQKVVAEAETAFGNVTILVNNAGILGPIAKTADISEEDFLKVCAINQNAVYLGM
KAVIPSMLKAKGGSIINVSSIAGMAANYGFPSLAYVGSKFAVRGMSKATAIEYGADNIRV
NSVHPGFIQTPMMVEGTDENGGEAVSMIPLGRIARASEVSNLVLFLASDESSYITGHEHV
VDGGLLAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory