SitesBLAST
Comparing WP_057507236.1 NCBI__GCF_001431535.1:WP_057507236.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
43% identity, 95% coverage: 8:322/330 of query aligns to 9:321/337 of Q3L181
- D52 (= D51) mutation to A: 99% loss of activity.
- Y57 (= Y56) mutation to A: 99% loss of activity.
- K84 (= K81) mutation to A: Total loss of activity.
- H126 (= H126) mutation to A: 98% loss of activity.
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
43% identity, 91% coverage: 8:306/330 of query aligns to 9:273/287 of 3v0sA
- active site: D45 (= D51), Y50 (= Y56), G87 (≠ R91), H119 (= H126)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (= S205), P199 (= P206), I200 (≠ L207), G201 (= G208), L204 (≠ F211), P246 (= P279), G247 (= G280), T248 (= T281), T249 (= T282), N253 (≠ R286), N256 (≠ E289), N257 (= N290)
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
33% identity, 94% coverage: 1:311/330 of query aligns to 1:310/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
33% identity, 94% coverage: 2:311/330 of query aligns to 1:309/311 of 1pz0A
- active site: D52 (= D51), Y57 (= Y56), N91 (≠ G96), H124 (= H126)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H126), Q174 (= Q176), Y202 (≠ F204), F203 (≠ S205), P204 (= P206), L205 (= L207), S207 (≠ A209), G208 (= G210), A211 (≠ T213), K213 (= K215)
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
34% identity, 92% coverage: 6:307/330 of query aligns to 19:286/286 of 8hnqA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G31 (= G18), M33 (= M20), R34 (≠ G21), Y71 (= Y56), R138 (= R127), Q187 (= Q176), W214 (≠ F204), A215 (≠ S205), P216 (= P206), L217 (= L207), S219 (≠ A209), G220 (= G210), I257 (= I278), P258 (= P279), G259 (= G280), T260 (= T281), K262 (= K283), H265 (≠ R286), E268 (= E289), N269 (= N290)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L98 (≠ F84), W106 (≠ R91), R138 (= R127)
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 95% coverage: 8:322/330 of query aligns to 5:325/333 of O14295
- S292 (≠ E289) modified: Phosphoserine
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 90% coverage: 9:306/330 of query aligns to 10:309/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 90% coverage: 9:306/330 of query aligns to 10:309/333 of 1pz1A
- active site: D52 (= D51), Y57 (= Y56), K90 (≠ D87), Q93 (≠ T90), H125 (= H126)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), W21 (≠ M20), Q175 (= Q176), Y203 (≠ F204), G204 (≠ S205), L206 (= L207), R208 (≠ A209), K214 (= K215), G280 (≠ I275), R282 (≠ P277), Q286 (≠ K283)
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
32% identity, 94% coverage: 1:311/330 of query aligns to 11:322/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (≠ S23), D59 (= D51), Y64 (= Y56), H136 (= H126), Q191 (= Q176), F220 (= F204), T221 (≠ S205), P222 (= P206), L223 (= L207), Q225 (≠ A209), G226 (= G210), K231 (= K215), R241 (≠ A236), R244 (= R239), L288 (≠ I278), G290 (= G280), S292 (≠ T282), Q296 (≠ R286), E299 (= E289), N300 (= N290)
Sites not aligning to the query:
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 94% coverage: 1:311/330 of query aligns to 1:293/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), L21 (≠ M20), Y50 (= Y56), H117 (= H126), S147 (= S156), Y200 (≠ F204), F201 (≠ S205), L203 (= L207), Q205 (≠ A209), T209 (= T213), Q268 (≠ R286), N272 (= N290)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 94% coverage: 1:311/330 of query aligns to 1:317/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), L21 (≠ M20), D49 (= D51), Y54 (= Y56), S151 (= S156), Y204 (≠ F204), F205 (≠ S205), L207 (= L207), Q209 (≠ A209), G210 (= G210), T213 (= T213), K215 (= K215), R227 (≠ F227), V284 (≠ I278), G286 (= G280), Q292 (≠ R286), N296 (= N290)
3n6qD Crystal structure of yghz from e. Coli (see paper)
31% identity, 94% coverage: 1:311/330 of query aligns to 12:309/315 of 3n6qD
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 95% coverage: 7:318/330 of query aligns to 14:350/351 of Q9P7U2
- S113 (= S99) modified: Phosphoserine
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
30% identity, 89% coverage: 1:295/330 of query aligns to 12:280/297 of 4aubE
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G30 (= G18), W32 (≠ S23), D60 (= D51), Y65 (= Y56), Q192 (= Q176), F221 (= F204), T222 (≠ S205), P223 (= P206), L224 (= L207), Q226 (≠ A209), T230 (= T213), K232 (= K215), L263 (≠ I278), G265 (= G280), S267 (≠ T282), Q271 (≠ R286), E274 (= E289), N275 (= N290)
Sites not aligning to the query:
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
29% identity, 93% coverage: 1:307/330 of query aligns to 2:272/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (≠ M20), Y59 (= Y56), W87 (≠ G95), H118 (= H126), R204 (≠ A209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), T21 (≠ C19), W22 (≠ M20), Y59 (= Y56), H118 (= H126), N149 (≠ E157), Q170 (= Q176), Y199 (≠ F204), S200 (= S205), P201 (= P206), L202 (= L207), R204 (≠ A209), T205 (≠ G210), Y227 (≠ A261), I243 (= I278), P244 (= P279), K245 (≠ G280), G247 (≠ T282), R248 (≠ K283), H251 (≠ R286), E254 (= E289), N255 (= N290)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
29% identity, 93% coverage: 1:307/330 of query aligns to 2:272/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
29% identity, 93% coverage: 1:307/330 of query aligns to 1:271/274 of 5danA
- active site: D53 (= D51), Y58 (= Y56), K84 (= K81), H117 (= H126)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (≠ C19), W21 (≠ M20), D53 (= D51), Y58 (= Y56), H117 (= H126), Q169 (= Q176), Y198 (≠ F204), S199 (= S205), P200 (= P206), L201 (= L207), R203 (≠ A209), Y226 (≠ A261), I242 (= I278), P243 (= P279), K244 (≠ G280), G246 (≠ T282), R247 (≠ K283), H250 (≠ R286), E253 (= E289), N254 (= N290)
8hw0A The structure of akr6d1
30% identity, 93% coverage: 1:308/330 of query aligns to 1:317/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), W21 (≠ M20), Q27 (≠ A29), D49 (= D51), Y54 (= Y56), R123 (= R127), S152 (= S156), Q178 (= Q176), W207 (≠ F204), S208 (= S205), P209 (= P206), L210 (= L207), S212 (≠ A209), K218 (= K215), S227 (≠ T220), R228 (≠ Q221), I285 (= I278), G287 (= G280), S289 (≠ T282), Q293 (≠ R286), D296 (≠ E289), N297 (= N290)
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
29% identity, 93% coverage: 1:308/330 of query aligns to 12:309/313 of 6hg6A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G30 (= G18), W32 (≠ S23), D60 (= D51), Y65 (= Y56), H137 (= H126), Q192 (= Q176), F221 (= F204), S222 (= S205), P223 (= P206), L224 (= L207), L278 (≠ I278), I279 (≠ P279), G280 (= G280), Q286 (≠ R286), E289 (= E289), N290 (= N290)
4aubF The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
29% identity, 94% coverage: 1:310/330 of query aligns to 11:298/298 of 4aubF
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (≠ S23), D59 (= D51), Y64 (= Y56), H136 (= H126), Q191 (= Q176), F220 (= F204), T221 (≠ S205), P222 (= P206), L223 (= L207), Q225 (≠ A209), L265 (≠ I278), G267 (= G280), S269 (≠ T282), Q273 (≠ R286), E276 (= E289), N277 (= N290)
Query Sequence
>WP_057507236.1 NCBI__GCF_001431535.1:WP_057507236.1
MKMRTLGQGLQVSALGLGCMGMSANYGPAADKHEMIALIRSAVERGVTHFDTAEVYGPYV
NEELLGEALQPVREQVVIATKFGFDLDPVTRARSGGTNSRPEQIKAVAEASLKRLRTDRI
DLFYQHRVDPAVPIEEVAGAVKDLIQAGKVKHFGLSEAGVQTIRRAHAVQPVTALQSEFS
LFWTEPRQSLLPVLEELGIGFVPFSPLGAGFLTGKIDATTQFDASDFRNAVPRFSAEARR
ANMTLVDVVKALAADKGATPAQVALAWLLAQKPWIAPIPGTTKLHRLEENLGAVDLVLDP
ADLQRIDQQLARIRISGDRLPEAAMKMTGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory