SitesBLAST
Comparing WP_057507247.1 NCBI__GCF_001431535.1:WP_057507247.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
40% identity, 98% coverage: 6:253/254 of query aligns to 12:264/265 of P07821
- K50 (= K44) mutation to Q: Lack of activity.
- D172 (= D162) mutation to E: Lack of activity.
- E173 (= E163) mutation to A: Lack of activity.
5x40A Structure of a cbio dimer bound with amppcp (see paper)
41% identity, 81% coverage: 21:227/254 of query aligns to 21:230/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: N40 (= N40), G41 (= G41), G43 (= G43), K44 (= K44), S45 (= S45), T46 (= T46), Q88 (≠ P85), H139 (≠ Q136), M140 (≠ Q137), L141 (= L138), S142 (= S139), G144 (= G141), Q145 (≠ E142), Q166 (≠ E163), H198 (= H195)
- binding magnesium ion: S45 (= S45), Q88 (≠ P85)
Sites not aligning to the query:
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
37% identity, 80% coverage: 31:234/254 of query aligns to 25:229/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
37% identity, 80% coverage: 31:234/254 of query aligns to 25:229/248 of 4fi3C
- binding phosphoaminophosphonic acid-adenylate ester: N34 (= N40), G35 (= G41), G37 (= G43), K38 (= K44), S39 (= S45), T40 (= T46), R121 (= R133), Q125 (= Q137), S127 (= S139), G129 (= G141), E130 (= E142), Q158 (≠ E163)
- binding magnesium ion: S39 (= S45), Q79 (= Q86)
Sites not aligning to the query:
Q9NP78 ABC-type oligopeptide transporter ABCB9; ATP-binding cassette sub-family B member 9; ATP-binding cassette transporter 9; ABC transporter 9 protein; hABCB9; TAP-like protein; TAPL; EC 7.4.2.6 from Homo sapiens (Human) (see 4 papers)
34% identity, 93% coverage: 8:242/254 of query aligns to 506:746/766 of Q9NP78
- K545 (= K44) mutation to A: Loss of peptide transport activity; whena ssociated with A-699.
- H699 (= H195) mutation to A: Loss of peptide transport activity; whena ssociated with A-545.
Sites not aligning to the query:
- 17 Intramolecular salt bridge with Arg-57. Essential for the release from the ER; D→N: Loss of lysosomal localization. Does not affect interaction between coreABCB9 and TMD0 domains. Does not affect dimerization. Does not affect peptide transport activity. Decreases interaction with YIF1B.; D→R: Loss of lysosomal localization. Does not affect lysosomal localization; when associated with D-57. Does not affect interaction between coreABCB9 and TMD0 domains. Does not affect interaction between coreABCB9 and TMD0 domains; when associated with D-57. Does not affect interaction between coreABCB9 and TMD0 domains; when associated with D-100.
- 45 Important for the second trafficking step from the Golgi to the endosomal and lysosomal compartments; D→K: Loss of lysosomal localization; when assosiated with K-49. Loss of lysosomal localization; when assosiated with K-49 and D-100. Does not affect peptide transport activity; when assosiated with K-49 and D-100.; D→N: Decreases lysosomal localization; when associated with N-49.
- 49 Important for the second trafficking step from the Golgi to the endosomal and lysosomal compartments; D→K: Loss of lysosomal localization; when assosiated with K-45. Loss of lysosomal localization; when assosiated with K-45 and D-100. Does not affect peptide transport activity; when assosiated with K-45 and D-100.; D→N: Decreases lysosomal localization; when associated with N-45.
- 57 Intramolecular salt bridge with Asp-17. Essential for the release from the ER; R→A: Decreases lysosomal localization. Loss of lysosomal localization; when associated with A-100.; R→D: Loss of lysosomal localization. Does not affect lysosomal localization; when associated with R-17. Does not affect interaction between coreABCB9 and TMD0 domains. Does not affect interaction between coreABCB9 and TMD0 domains; when associated with R-17.
- 100 K→A: Decreases lysosomal localization. Loss of lysosomal localization; when associated with A-57.; K→D: Decreases lysosomal localization. Loss of lysosomal localization; when assosiated with R-17. Loss of lysosomal localization; when assosiated with K-45 and K-49. Does not affect peptide transport activity; when assosiated with K-45 and K-49. Does not affect interaction between coreABCB9 and TMD0 domains. Does not affect interaction between coreABCB9 and TMD0 domains; when associated with R-17.
- 121 V → M: in dbSNP:rs3803002
- 136:137 LL→AA: No effect on lysosomal localization.
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 89% coverage: 3:227/254 of query aligns to 12:238/378 of P69874
- C26 (vs. gap) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (vs. gap) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V33) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A42) mutation to T: Loss of ATPase activity and transport.
- L60 (= L48) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L64) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ A125) mutation to M: Loss of ATPase activity and transport.
- D172 (= D162) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
27% identity, 91% coverage: 4:234/254 of query aligns to 1:233/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 81% coverage: 20:225/254 of query aligns to 16:224/240 of 4ymuJ
- binding adenosine-5'-triphosphate: V16 (≠ I20), S36 (≠ N40), G37 (= G41), S38 (≠ A42), G39 (= G43), K40 (= K44), S41 (= S45), T42 (= T46), E162 (= E163), H194 (= H195)
- binding magnesium ion: S41 (= S45), E162 (= E163)
Sites not aligning to the query:
2onjA Structure of the multidrug abc transporter sav1866 from s. Aureus in complex with amp-pnp (see paper)
30% identity, 83% coverage: 16:227/254 of query aligns to 352:565/578 of 2onjA
- binding phosphoaminophosphonic acid-adenylate ester: I356 (= I20), S376 (≠ N40), G377 (= G41), G378 (≠ A42), G379 (= G43), K380 (= K44), S381 (= S45), T382 (= T46), Q422 (= Q86), K477 (≠ Q137), S479 (= S139), G480 (= G140), E503 (= E163), H534 (= H195)
Sites not aligning to the query:
2hydA Multidrug abc transporter sav1866 (see paper)
30% identity, 83% coverage: 16:227/254 of query aligns to 352:565/578 of 2hydA
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
33% identity, 87% coverage: 3:224/254 of query aligns to 1:225/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ R15), Q14 (= Q16), T16 (≠ R18), V18 (≠ I20), S38 (≠ N40), G39 (= G41), C40 (≠ A42), G41 (= G43), K42 (= K44), T43 (≠ S45), T44 (= T46), R133 (= R133), E137 (≠ Q137), S139 (= S139), G141 (= G141), Q142 (≠ E142)
- binding calcium ion: T43 (≠ S45), Q86 (= Q86)
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
34% identity, 96% coverage: 6:250/254 of query aligns to 4:249/262 of 7chaI
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 91% coverage: 3:234/254 of query aligns to 1:234/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 91% coverage: 4:234/254 of query aligns to 1:233/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (≠ R15), R15 (= R18), V17 (≠ I20), N37 (= N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (= T46)
- binding magnesium ion: T42 (≠ S45), Q84 (= Q86)
- binding novobiocin: L71 (≠ A74), H72 (≠ G75), P83 (= P85), A86 (≠ H88), S87 (≠ A89), F89 (≠ R91), R90 (≠ F92), R91 (≠ A93), L92 (≠ F94), V101 (≠ M102), Q135 (= Q136), R149 (= R150)
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 91% coverage: 4:234/254 of query aligns to 1:233/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 91% coverage: 4:234/254 of query aligns to 1:233/233 of 6b8bA
- binding adenosine-5'-diphosphate: Y12 (≠ R15), R15 (= R18), V17 (≠ I20), G38 (= G41), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (= T46)
- binding (3s,5s,7s)-N-{7-[(3-O-carbamoyl-6-deoxy-5-methyl-4-O-methyl-beta-D-gulopyranosyl)oxy]-4-hydroxy-8-methyl-2-oxo-2H-1-benzopyran-3-yl}tricyclo[3.3.1.1~3,7~]decane-1-carboxamide: F89 (≠ R91), R90 (≠ F92), R91 (≠ A93)
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 91% coverage: 4:234/254 of query aligns to 1:233/235 of 6mhzA
- binding adp orthovanadate: Y12 (≠ R15), N37 (= N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (= T46), Q84 (= Q86), S136 (≠ Q137), S138 (= S139), G139 (= G140), G140 (= G141), E162 (= E163), G166 (≠ A167), H194 (= H195)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 91% coverage: 4:234/254 of query aligns to 1:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 91% coverage: 4:234/254 of query aligns to 1:233/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (≠ R15), R15 (= R18), N37 (= N40), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (= T46), Q84 (= Q86), S136 (≠ Q137), S138 (= S139), E141 (= E142)
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
33% identity, 87% coverage: 4:224/254 of query aligns to 3:228/263 of 7d0aB
Query Sequence
>WP_057507247.1 NCBI__GCF_001431535.1:WP_057507247.1
MNSALLSLRQVGVVRQQRPILADVELAFAPGTVTALVGPNGAGKSTLLGVACGDLQPDSG
EVLLAGTPLSALRAGALARQRAVMPQEHAVRFAFSVEEVVAMGRLPHPPAPAEDARRVEA
ALDAAELQALRQREVQQLSGGESARTTFARVLAQDTPLLFLDEPTAALDLRHQERTLRSV
RTLADQGACVIVVLHDLNLAAGHADRIVLLERGRVAADGTPREVLTEDTLRRVYQQDVLV
LQHPRRPVPLVVVT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory