SitesBLAST
Comparing WP_057507305.1 NCBI__GCF_001431535.1:WP_057507305.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
54% identity, 99% coverage: 1:461/468 of query aligns to 1:461/471 of P04805
- C98 (≠ A98) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ E100) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ A125) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ E127) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ N129) mutation to Q: No change in activity or in zinc content.
- H131 (≠ P131) mutation to Q: No change in activity or in zinc content.
- H132 (≠ Y132) mutation to Q: No change in activity or in zinc content.
- C138 (≠ R138) mutation to S: No change in activity or in zinc content.
- S239 (= S239) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
54% identity, 99% coverage: 1:461/468 of query aligns to 1:461/468 of 8i9iA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
51% identity, 78% coverage: 3:366/468 of query aligns to 3:354/380 of 4g6zA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
40% identity, 97% coverage: 1:452/468 of query aligns to 1:471/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y181) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
40% identity, 96% coverage: 2:452/468 of query aligns to 1:470/484 of 2cfoA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
37% identity, 98% coverage: 3:461/468 of query aligns to 103:559/564 of 3al0C
- active site: S110 (= S10), K335 (= K240)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (= T22), E142 (= E42), Y276 (= Y181), R294 (= R199), G295 (= G200), D297 (= D202), H298 (= H203), L324 (≠ M229), I325 (= I230), L333 (= L238)
- binding : T144 (= T44), D145 (= D45), R148 (= R48), Y208 (≠ E100), P213 (≠ A107), K252 (= K157), M255 (≠ I160), I266 (≠ V171), K269 (≠ R174), S270 (≠ P175), Y276 (= Y181), D297 (= D202), H298 (= H203), L299 (≠ I204), S300 (≠ N205), N301 (= N206), K304 (≠ R209), R330 (≠ G235), P332 (≠ K237), G363 (= G268), W364 (= W269), R365 (≠ S270), E370 (= E275), S387 (≠ N292), K389 (= K294), V391 (≠ A296), I392 (≠ R297), K397 (= K302), W400 (= W305), R407 (≠ K312), E446 (= E349), K447 (≠ R350), Q453 (≠ E356), I457 (≠ K360), R509 (≠ H411), K520 (≠ G422), Q524 (= Q426), R527 (= R429), V535 (= V437), T536 (≠ S438), G538 (≠ D440), L539 (≠ I441)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
34% identity, 98% coverage: 3:461/468 of query aligns to 3:498/502 of 6brlA
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of 1g59A
- binding : D44 (= D45), R45 (= R46), A46 (≠ E47), R47 (= R48), P109 (≠ R102), V145 (= V139), R163 (≠ K157), V166 (≠ I160), E172 (= E166), V177 (= V171), K180 (≠ R174), S181 (≠ P175), D182 (= D176), E207 (≠ D201), E208 (≠ D202), R237 (≠ L231), K241 (≠ G235), T242 (≠ A236), K243 (= K237), M273 (≠ L267), G274 (= G268), E282 (= E275), S299 (≠ N292), L300 (≠ S293), P303 (≠ A296), V304 (≠ R297), K309 (= K302), W312 (= W305), R319 (≠ K312), P357 (≠ E349), R358 (= R350), R417 (≠ H411), K426 (≠ G420), L427 (≠ M421), Q432 (= Q426), R435 (= R429), L442 (≠ Q436), E443 (≠ V437), T444 (≠ S438), P445 (= P439), G446 (≠ D440), L447 (≠ I441), F448 (≠ S442)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of 2cv2A
- active site: K246 (= K240)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (≠ T22), E41 (= E42), Y187 (= Y181), R205 (= R199), A206 (≠ G200), E208 (≠ D202), W209 (≠ H203), L235 (≠ M229), L236 (≠ I230)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V139), R163 (≠ K157), Y168 (≠ I162), E172 (= E166), V177 (= V171), K180 (≠ R174), S181 (≠ P175), Y187 (= Y181), E207 (≠ D201), E208 (≠ D202), W209 (≠ H203), V211 (≠ N205), R237 (≠ L231), K241 (≠ G235), L272 (≠ R266), M273 (≠ L267), G274 (= G268), E282 (= E275), S299 (≠ N292), P303 (≠ A296), V304 (≠ R297), K309 (= K302), W312 (= W305), R319 (≠ K312), P357 (≠ E349), R358 (= R350), R417 (≠ H411), Q432 (= Q426), R435 (= R429), L442 (≠ Q436), E443 (≠ V437), T444 (≠ S438), G446 (≠ D440), L447 (≠ I441), F448 (≠ S442)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of 2cv1A
- active site: K246 (= K240)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ G19), I21 (≠ T22), R47 (= R48), A206 (≠ G200), W209 (≠ H203), L235 (≠ M229), L236 (≠ I230)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (= E42), Y187 (= Y181), R205 (= R199), W209 (≠ H203)
- binding : S9 (= S10), E41 (= E42), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V139), R163 (≠ K157), V166 (≠ I160), E172 (= E166), V177 (= V171), K180 (≠ R174), S181 (≠ P175), Y187 (= Y181), E207 (≠ D201), E208 (≠ D202), W209 (≠ H203), V211 (≠ N205), R237 (≠ L231), K241 (≠ G235), K243 (= K237), M273 (≠ L267), G274 (= G268), S276 (= S270), E282 (= E275), S299 (≠ N292), P303 (≠ A296), V304 (≠ R297), K309 (= K302), W312 (= W305), R319 (≠ K312), P357 (≠ E349), R358 (= R350), R417 (≠ H411), L427 (≠ M421), Q432 (= Q426), R435 (= R429), L442 (≠ Q436), E443 (≠ V437), T444 (≠ S438), G446 (≠ D440), L447 (≠ I441), F448 (≠ S442)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of 1n78A
- active site: K246 (= K240)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ G19), I21 (≠ T22), E41 (= E42), Y187 (= Y181), N191 (≠ V185), R205 (= R199), A206 (≠ G200), E208 (≠ D202), W209 (≠ H203), L235 (≠ M229), L236 (≠ I230)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V139), R163 (≠ K157), V166 (≠ I160), Y168 (≠ I162), E172 (= E166), V177 (= V171), K180 (≠ R174), S181 (≠ P175), Y187 (= Y181), E207 (≠ D201), E208 (≠ D202), W209 (≠ H203), L210 (≠ I204), V211 (≠ N205), R237 (≠ L231), K241 (≠ G235), M273 (≠ L267), G274 (= G268), E282 (= E275), R297 (≠ N290), P303 (≠ A296), V304 (≠ R297), K309 (= K302), W312 (= W305), R319 (≠ K312), P357 (≠ E349), R358 (= R350), R417 (≠ H411), L427 (≠ M421), Q432 (= Q426), R435 (= R429), L442 (≠ Q436), E443 (≠ V437), T444 (≠ S438), G446 (≠ D440), L447 (≠ I441), F448 (≠ S442)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of 1j09A
- active site: K246 (= K240)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (≠ D202), L235 (≠ M229), L236 (≠ I230), K243 (= K237), I244 (≠ L238), S245 (= S239), K246 (= K240), R247 (= R241)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y187 (= Y181), N191 (≠ V185), R205 (= R199), W209 (≠ H203)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 98% coverage: 5:461/468 of query aligns to 4:467/468 of P27000
- R358 (= R350) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
32% identity, 98% coverage: 2:460/468 of query aligns to 1:478/485 of 4griB
- active site: S9 (= S10), K253 (= K240)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y194 (= Y181), R212 (= R199), W216 (≠ H203)
- binding zinc ion: C105 (≠ A98), C107 (≠ E100), Y128 (= Y121), C132 (≠ A125)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
33% identity, 100% coverage: 2:468/468 of query aligns to 3:473/488 of 8vc5A
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
40% identity, 51% coverage: 6:244/468 of query aligns to 19:245/308 of P27305
- E55 (= E42) binding
- Y182 (= Y181) binding
- R200 (= R199) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
40% identity, 51% coverage: 6:244/468 of query aligns to 7:233/290 of 4a91A
- active site: S11 (= S10), K229 (= K240)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (= E42), Y170 (= Y181), R188 (= R199), L192 (≠ H203)
- binding zinc ion: C99 (≠ A98), C101 (≠ E100), Y113 (= Y121), C117 (≠ A125)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
32% identity, 47% coverage: 6:226/468 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 42% coverage: 5:199/468 of query aligns to 204:400/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>WP_057507305.1 NCBI__GCF_001431535.1:WP_057507305.1
MTCRTRFAPSPTGYLHIGGARTALYCWLEARHRGGEFVLRIEDTDRERSTQGAIDAILEA
MEWLGLDYDEGPIYQTQRVARYLEVAQQLVADGKAYYAYETREELDAMREAAMAKQEKPR
YNGAAREQNLPYRDDPNRVIRFKNPLDGTVVFDDLIKGPIEIANSELDDMVIFRPDGYPT
YNFAVVVDDWDMGITEVIRGDDHINNTPRQINLYLGIGAPVPKFGHMPMILDEQGAKLSK
RTGAADVMQYKDAGYLPEALLSYLARLGWSHGDQEIFSRQELIDLFDVTNCNSKAARLDM
AKLGWVNQHFLKTEAAASIAPALVYQLEKLGLDLNAGPSAEDVVVALRERVQTLKEMAEK
AVVWYQPLETYDEAAVAKHLKPGAELPLGKARELLAALPAWTAESVGVALHDAAAALEIG
MGKVAQPLRVAITGTQVSPDISQTVYLAGRDEALKRIDVAITKVVAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory