SitesBLAST
Comparing WP_057507659.1 NCBI__GCF_001431535.1:WP_057507659.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
66% identity, 98% coverage: 4:212/214 of query aligns to 18:226/229 of P77165
- C99 (= C85) binding
- C104 (= C90) binding
- G105 (= G91) binding
- C107 (= C93) binding
- C119 (= C105) binding
- C158 (= C144) binding
- C161 (= C147) binding
- C208 (= C194) binding
- C210 (= C196) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
75% identity, 79% coverage: 43:212/214 of query aligns to 6:175/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G84), C48 (= C85), D49 (= D86), G51 (= G88), C53 (= C90), G54 (= G91), C56 (= C93), C68 (= C105), C107 (= C144), G108 (= G145), C110 (= C147), C157 (= C194), C159 (= C196)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
56% identity, 78% coverage: 49:214/214 of query aligns to 5:156/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G84), C41 (= C85), D42 (= D86), G44 (= G88), C46 (= C90), G47 (= G91), C49 (= C93), C61 (= C105), C101 (= C144), G102 (= G145), C104 (= C147), C136 (= C194), C138 (= C196)
- binding pterin cytosine dinucleotide: Q100 (= Q143), C138 (= C196)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
43% identity, 75% coverage: 49:208/214 of query aligns to 6:150/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ K83), C42 (= C85), E43 (≠ D86), G45 (= G88), C47 (= C90), G48 (= G91), C50 (= C93), R60 (≠ N103), C62 (= C105), C101 (= C144), G102 (= G145), C104 (= C147), C136 (= C194), C138 (= C196)
- binding pterin cytosine dinucleotide: Q100 (= Q143), C138 (= C196)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
43% identity, 75% coverage: 48:207/214 of query aligns to 11:154/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C85), S50 (≠ G88), C52 (= C90), G53 (= G91), C55 (= C93), C67 (= C105), C106 (= C144), G107 (= G145), C109 (= C147), C141 (= C194), C143 (= C196)
- binding pterin cytosine dinucleotide: Q105 (= Q143), C143 (= C196)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), C40 (= C85), E41 (≠ D86), G43 (= G88), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), Q99 (= Q143), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/907 of Q46509
- C40 (= C85) binding
- C45 (= C90) binding
- C48 (= C93) binding
- C60 (= C105) binding
- C100 (= C144) binding
- C103 (= C147) binding
- C137 (= C194) binding
- C139 (= C196) binding
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
42% identity, 73% coverage: 53:208/214 of query aligns to 8:151/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K83), G39 (= G84), C40 (= C85), G41 (≠ D86), G43 (= G88), Q44 (= Q89), C45 (= C90), G46 (= G91), C48 (= C93), R58 (≠ N103), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C137 (= C194), C139 (= C196)
- binding pterin cytosine dinucleotide: Q99 (= Q143), C139 (= C196)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
41% identity, 74% coverage: 49:207/214 of query aligns to 5:148/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C85), S44 (≠ G88), H45 (≠ Q89), C46 (= C90), G47 (= G91), C49 (= C93), C61 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C135 (= C194), C137 (= C196)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
41% identity, 74% coverage: 49:207/214 of query aligns to 4:147/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ K83), C40 (= C85), S43 (≠ G88), C45 (= C90), G46 (= G91), C48 (= C93), C60 (= C105), C99 (= C144), G100 (= G145), C102 (= C147), C134 (= C194), C136 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q143), C136 (= C196)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
42% identity, 76% coverage: 51:213/214 of query aligns to 7:154/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ K83), C41 (= C85), G44 (= G88), C46 (= C90), G47 (= G91), C49 (= C93), C61 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C135 (= C194), C137 (= C196)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q143), C137 (= C196)
7dqxC Crystal structure of xanthine dehydrogenase family protein
42% identity, 75% coverage: 49:208/214 of query aligns to 6:151/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C85), G45 (= G88), V46 (≠ Q89), C47 (= C90), C50 (= C93), R60 (≠ N103), C62 (= C105), Q100 (= Q143), C101 (= C144), C104 (= C147), C137 (= C194), C139 (= C196)
- binding pterin cytosine dinucleotide: Q100 (= Q143), C139 (= C196)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
41% identity, 75% coverage: 47:207/214 of query aligns to 4:150/166 of P19921
- C42 (= C85) binding
- C47 (= C90) binding
- C50 (= C93) binding
- C62 (= C105) binding
- C102 (= C144) binding
- C105 (= C147) binding
- C137 (= C194) binding
- C139 (= C196) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
41% identity, 75% coverage: 47:207/214 of query aligns to 2:148/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G88), H44 (≠ Q89)
- binding fe2/s2 (inorganic) cluster: I38 (≠ K83), G39 (= G84), C40 (= C85), S43 (≠ G88), C45 (= C90), G46 (= G91), C48 (= C93), C60 (= C105), C100 (= C144), G101 (= G145), C103 (= C147), C135 (= C194), C137 (= C196)
Query Sequence
>WP_057507659.1 NCBI__GCF_001431535.1:WP_057507659.1
MTTPPEFALSRRTLLKLGAGSASVLVAPAAMADVPGIASPARAPVTAEVAFKVNGKARAL
KLDTRVTLLDALREHLHLTGTKKGCDHGQCGACTVIVDGRRINACLSLAVMHEGAEITTI
EGLGSPDDLHPMQAAFVKHDGYQCGYCTPGQICSAVAVLKEIKDGIPSHVTADLGARSEA
SAEEIRERMSGNLCRCGAYSNIIEAIEDVGGQRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory