Comparing WP_057507751.1 NCBI__GCF_001431535.1:WP_057507751.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
59% identity, 95% coverage: 17:442/450 of query aligns to 7:431/439 of Q9A3Q9
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
49% identity, 99% coverage: 7:450/450 of query aligns to 4:448/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
49% identity, 96% coverage: 18:450/450 of query aligns to 9:441/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
48% identity, 96% coverage: 18:450/450 of query aligns to 3:435/435 of 4uhmA
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
49% identity, 95% coverage: 19:447/450 of query aligns to 9:438/441 of 3a8uX
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
37% identity, 94% coverage: 22:442/450 of query aligns to 11:431/443 of 6fyqA
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
39% identity, 91% coverage: 33:442/450 of query aligns to 27:440/454 of 7ypmA
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
38% identity, 91% coverage: 33:442/450 of query aligns to 22:430/444 of 3i5tA
Sites not aligning to the query:
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
38% identity, 91% coverage: 33:442/450 of query aligns to 27:440/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 94% coverage: 25:446/450 of query aligns to 19:443/448 of 6io1B
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
38% identity, 95% coverage: 25:450/450 of query aligns to 17:446/450 of 6gwiB
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 92% coverage: 37:450/450 of query aligns to 35:457/460 of 5kr6B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
36% identity, 90% coverage: 37:440/450 of query aligns to 2:408/422 of 7qx3A
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 91% coverage: 22:430/450 of query aligns to 10:427/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 91% coverage: 22:430/450 of query aligns to 12:429/449 of 5lh9D
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
33% identity, 94% coverage: 25:449/450 of query aligns to 16:447/459 of D6R3B6
6s54A Transaminase from pseudomonas fluorescens (see paper)
35% identity, 90% coverage: 36:442/450 of query aligns to 31:444/453 of 6s54A
Sites not aligning to the query:
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 90% coverage: 37:441/450 of query aligns to 34:445/458 of 5kr3A
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
37% identity, 96% coverage: 12:441/450 of query aligns to 1:436/453 of 6s4gA
7q9xAAA Probable aminotransferase
37% identity, 96% coverage: 12:441/450 of query aligns to 2:437/455 of 7q9xAAA
>WP_057507751.1 NCBI__GCF_001431535.1:WP_057507751.1
MPSPTPPINVLATTQPDTLDAFWMPFTANAQFKGAPRLLVRAQGMYYEDVEGRQILDGTA
GLWCCNAGHGRKKIVQAIAEQAGTLDFAPTFQMGSPLPFVLAQRLAALAPAGLNHVFFTN
SGSEAVDSAMKIVLAHHRARGEGQRTRFIGREKAYHGVGFGGMAIGGLPNNRRQFGLQLG
GSAHLPHTLDLQRNAFSQGLPRHGAELADALERLIALHDASTIAAVFVEPIAGSAGVILP
APGYLQRLREICDHHGIVLVFDEVITGFGRVGMPFAAQRFGVTPDLITFAKGASNGAVPL
GGVLVGDAIHSSLQQGPTQAIDLFHGYTYSGHPLACAAALATLDVYAEERLFERAIELGE
HWQRALHGLQGLPNVVDIRNFGLVGAVELAPRRDAPGSRGYEVFRRCFHDGNLLVRQTGD
TIALSPPLIVEPAQIDQIADVLGAMIRATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory