Comparing WP_057507761.1 NCBI__GCF_001431535.1:WP_057507761.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7d53A Spua mutant - h221n with glu (see paper)
48% identity, 95% coverage: 5:245/253 of query aligns to 4:245/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
48% identity, 95% coverage: 5:245/253 of query aligns to 10:251/255 of 7d50B
7d4rB Spua native structure (see paper)
42% identity, 95% coverage: 5:245/253 of query aligns to 2:213/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
37% identity, 96% coverage: 5:247/253 of query aligns to 8:253/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
37% identity, 96% coverage: 5:247/253 of query aligns to 6:251/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
35% identity, 87% coverage: 26:244/253 of query aligns to 11:222/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 87% coverage: 27:246/253 of query aligns to 92:304/308 of O33341
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 48% coverage: 108:228/253 of query aligns to 99:198/693 of P49915
Sites not aligning to the query:
>WP_057507761.1 NCBI__GCF_001431535.1:WP_057507761.1
MRLPPLVGLPTDSSLQGHHRFAMAGEKYVRALVDAAAVTPVLLPSLQPPLPAGDWLSRVH
GLLLTGAVSNIEPQHYAGGRTWPGNLHDPARDGAAFSLLVHALAADLPVLAICRGFQELN
VALGGTLHPQVHRVEGRHDHREDPAASVEVQYGPAHSIALVAGGWLAQWHGARSAVVNSV
HGQGIDSLADALLPEAHADDGLVEAARSRRHSFVLGVQWHPEWRVTHNPFYHAVFHAFGQ
ACRQRQRRQQDSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory