Comparing WP_057507870.1 NCBI__GCF_001431535.1:WP_057507870.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
55% identity, 99% coverage: 5:375/375 of query aligns to 6:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
55% identity, 99% coverage: 5:374/375 of query aligns to 6:375/375 of 4pqaA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
56% identity, 96% coverage: 15:375/375 of query aligns to 16:376/377 of 7t1qA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
51% identity, 99% coverage: 4:374/375 of query aligns to 5:375/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
51% identity, 99% coverage: 4:374/375 of query aligns to 9:379/380 of 5vo3A
7lgpB Dape enzyme from shigella flexneri
52% identity, 99% coverage: 4:375/375 of query aligns to 7:377/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
55% identity, 47% coverage: 4:179/375 of query aligns to 7:182/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
54% identity, 47% coverage: 2:179/375 of query aligns to 3:180/265 of 4op4B
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 87% coverage: 48:375/375 of query aligns to 55:383/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
31% identity, 63% coverage: 11:245/375 of query aligns to 12:250/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
30% identity, 51% coverage: 16:207/375 of query aligns to 33:235/426 of 3pfoA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
27% identity, 43% coverage: 39:199/375 of query aligns to 96:264/503 of Q8C165
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 83% coverage: 61:373/375 of query aligns to 75:398/408 of Q03154
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
26% identity, 36% coverage: 11:146/375 of query aligns to 30:171/458 of 2pokA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
24% identity, 70% coverage: 61:324/375 of query aligns to 94:417/475 of Q96KP4
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
37% identity, 21% coverage: 61:138/375 of query aligns to 127:204/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
38% identity, 20% coverage: 63:138/375 of query aligns to 98:173/471 of 3dljA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
22% identity, 95% coverage: 19:373/375 of query aligns to 29:397/407 of P37111
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
26% identity, 83% coverage: 30:339/375 of query aligns to 57:350/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
26% identity, 83% coverage: 30:339/375 of query aligns to 82:375/415 of P06621
Sites not aligning to the query:
>WP_057507870.1 NCBI__GCF_001431535.1:WP_057507870.1
MSAVLDLACDLIARPSVTPDDAGCQQLLATRLQAAGFQCEHLRLGEVDNLWATHGSGGPV
LVLLGHTDVVPTGPVADWASDPFVPTVRDGVLYGRGAADMKGSVAAFVVAAEQFVAAHPE
HPGTLAVLLTSDEEGDAIDGVRHVARLFAERGERIDWCITGEPSSTARLGDLLRVGRRGS
LSARLLVQGVQGHVAYPDKARNPIHQAAPALAELTARRWDEGFESFPPTSLQVSNVHAGT
GANNVIPGQLQVDFNLRYNPHWNADKLETEIAALLDRHGLEYTVKWHRSGEPFHTPEGTL
RRVAREVLGEFAGAPPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDENVRVDDLE
QLPALYQRLIERLLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory