SitesBLAST
Comparing WP_057507948.1 NCBI__GCF_001431535.1:WP_057507948.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
63% identity, 99% coverage: 7:892/894 of query aligns to 340:1225/1227 of P13009
- E694 (= E359) binding
- GDVHD 756:760 (= GDVHD 425:429) binding
- D757 (= D426) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H428) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S473) binding
- T808 (= T477) binding
- S810 (= S479) mutation to A: Decreases activity by about 40%.
- A860 (= A529) binding
- D946 (= D616) binding
- R1134 (= R801) binding
- YY 1189:1190 (≠ YF 856:857) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
53% identity, 99% coverage: 6:892/894 of query aligns to 354:1263/1265 of Q99707
- GSR 382:384 (≠ GSA 34:36) binding
- D449 (= D101) binding
- N470 (= N122) binding
- D537 (= D189) binding
- N579 (= N231) binding
- R585 (= R237) binding
- R591 (= R243) binding
- D919 (≠ R562) to G: in dbSNP:rs1805087
- D963 (= D605) mutation to E: Decreases binding to MTRR; when associated with N-1071.
- K1071 (= K701) mutation to N: Decreases binding to MTRR; when associated with E-963.
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
58% identity, 64% coverage: 319:892/894 of query aligns to 4:575/576 of 3ivaA
- active site: D107 (= D426), H109 (= H428), S160 (= S479)
- binding cobalamin: H109 (= H428), G112 (= G431), V116 (= V435), G152 (= G471), L153 (= L472), S154 (= S473), L156 (= L475), I157 (= I476), T158 (= T477), G183 (= G502), G184 (= G503), Q208 (≠ K527), N209 (≠ D528), T303 (≠ A623), D443 (= D760), A486 (= A803), G488 (= G805), Y489 (= Y806), H495 (= H812), A520 (= A837), M521 (= M838), G524 (≠ T841), V527 (= V844), S528 (= S845)
- binding s-adenosyl-l-homocysteine: E447 (= E764), R484 (= R801), P485 (= P802), Y489 (= Y806), A491 (= A808), Y539 (= Y856)
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
58% identity, 64% coverage: 319:892/894 of query aligns to 4:575/577 of 3bulA
- active site: D107 (= D426), H109 (= H428), S160 (= S479)
- binding cobalamin: H109 (= H428), V116 (= V435), G152 (= G471), L153 (= L472), S154 (= S473), L156 (= L475), I157 (= I476), T158 (= T477), G183 (= G502), G184 (= G503), Q208 (≠ K527), N209 (≠ D528), A210 (= A529), T213 (≠ A532), M302 (≠ Q622), D443 (= D760), A486 (= A803), P487 (= P804), G488 (= G805), Y489 (= Y806), H495 (= H812), K498 (= K815), M521 (= M838), G524 (≠ T841), V527 (= V844), S528 (= S845)
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
68% identity, 32% coverage: 23:306/894 of query aligns to 4:286/287 of 3k13C
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E9 (= E28), G15 (= G34), R17 (≠ A36), N103 (= N122), D170 (= D189), G209 (= G228), S211 (= S230), N212 (= N231), R218 (= R237), R224 (= R243), I244 (= I263)
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
61% identity, 33% coverage: 6:303/894 of query aligns to 314:611/611 of 4cczA
- binding (6s)-5,6,7,8-tetrahydrofolate: E336 (= E28), G342 (= G34), R344 (≠ A36), N430 (= N122), M458 (= M150), D497 (= D189), G536 (= G228), S538 (= S230), N539 (= N231), F542 (= F234), R545 (= R237), R551 (= R243)
1mskA Methionine synthase (activation domain) (see paper)
53% identity, 36% coverage: 573:892/894 of query aligns to 4:325/327 of 1mskA
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
53% identity, 36% coverage: 573:892/894 of query aligns to 4:325/326 of 6bdyA
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
65% identity, 27% coverage: 319:563/894 of query aligns to 4:244/246 of 1bmtA
- active site: D107 (= D426), H109 (= H428), S160 (= S479)
- binding co-methylcobalamin: E44 (= E359), M48 (= M363), M51 (= M366), G55 (= G370), L65 (= L380), V68 (= V383), D107 (= D426), V108 (= V427), H109 (= H428), D110 (= D429), I111 (= I430), I115 (= I434), G152 (= G471), L153 (= L472), S154 (= S473), L156 (= L475), I157 (= I476), T158 (= T477), G183 (= G502), G184 (= G503), A185 (= A504), V207 (= V526), N209 (≠ D528), A210 (= A529)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
35% identity, 58% coverage: 23:542/894 of query aligns to 332:835/841 of 8g3hA
- binding cobalamin: F675 (= F373), V685 (= V383), K693 (= K391), G720 (= G425), V722 (= V427), H723 (= H428), D724 (= D429), I725 (= I430), G726 (= G431), V730 (= V435), M767 (≠ L472), S768 (= S473), L770 (= L475), V772 (≠ T477), I795 (≠ M500), L796 (≠ I501), G797 (= G502), G798 (= G503), A799 (= A504), Y818 (≠ W525), A819 (≠ V526), E820 (≠ K527), D821 (= D528)
Sites not aligning to the query:
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
32% identity, 60% coverage: 323:859/894 of query aligns to 1:506/507 of 8sseA
- binding cobalamin: H97 (= H428), G100 (= G431), V104 (= V435), S142 (= S473), L145 (≠ I476), V146 (≠ T477), I169 (≠ M500), G171 (= G502), G172 (= G503), A173 (= A504), H405 (≠ K756), V409 (≠ D760), S451 (≠ A803), F452 (≠ P804), G453 (= G805), Y454 (= Y806), Q463 (≠ K815), L485 (≠ M838), E488 (≠ T841), A490 (= A843), S492 (= S845)
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
35% identity, 31% coverage: 22:299/894 of query aligns to 2:273/282 of 5vooA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E7 (= E28), R8 (= R29), G13 (= G34), S14 (= S35), K15 (≠ A36), D77 (= D101), N98 (= N122), D165 (= D189), G204 (= G228), N207 (= N231), F210 (= F234), R217 (= R243), I237 (= I263)
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
33% identity, 20% coverage: 328:508/894 of query aligns to 43:216/258 of 2i2xB
- active site: D134 (= D426), H136 (= H428), T187 (≠ S479)
- binding 5-hydroxybenzimidazolylcob(iii)amide: G133 (= G425), D134 (= D426), V135 (= V427), H136 (= H428), D137 (= D429), I138 (= I430), G139 (= G431), V143 (= V435), T179 (≠ G471), T181 (≠ S473), L183 (= L475), M184 (≠ I476), T185 (= T477), A208 (≠ M500), G210 (= G502), G211 (= G503), G212 (≠ A504)
Sites not aligning to the query:
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
33% identity, 20% coverage: 328:508/894 of query aligns to 43:216/258 of Q46EH4
- H129 (≠ A421) mutation to K: Does not affect cobalamin-binding.
- H136 (= H428) mutation H->G,K: Abolishes cobalamin-binding.
Sites not aligning to the query:
- 256:258 HKH→KKK: Does not affect cobalamin-binding.
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
29% identity, 19% coverage: 337:508/894 of query aligns to 19:188/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D426), I105 (≠ V427), H106 (= H428), I108 (= I430), G109 (= G431), V113 (= V435), S150 (≠ L472), S151 (= S473), L153 (= L475), M154 (≠ I476), T155 (= T477), M180 (= M500), G182 (= G502), G183 (= G503)
Sites not aligning to the query:
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
35% identity, 16% coverage: 365:503/894 of query aligns to 45:174/206 of 4jgiB
- active site: D95 (= D426), H97 (= H428), A148 (≠ S479)
- binding co-methylcobalamin: L63 (≠ V383), D95 (= D426), L96 (≠ V427), H97 (= H428), D98 (= D429), I99 (= I430), G100 (= G431), F104 (≠ V435), G140 (= G471), S142 (= S473), L145 (≠ I476), G173 (= G502), G174 (= G503)
Sites not aligning to the query:
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
32% identity, 21% coverage: 322:507/894 of query aligns to 3:185/212 of 3ezxA
- active site: D100 (= D426), H102 (= H428), S155 (= S479)
- binding 5-hydroxybenzimidazolylcobamide: M47 (= M366), F54 (= F373), D100 (= D426), I101 (≠ V427), H102 (= H428), D103 (= D429), I104 (= I430), V109 (= V435), V147 (≠ I470), S149 (= S473), L151 (= L475), M152 (≠ I476), T153 (= T477), M178 (= M500), G180 (= G502), G181 (= G503)
Sites not aligning to the query:
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
37% identity, 11% coverage: 414:508/894 of query aligns to 3:99/125 of 1y80A
- active site: D15 (= D426), H17 (= H428), T68 (≠ S479)
- binding co-5-methoxybenzimidazolylcobamide: D15 (= D426), L16 (≠ V427), H17 (= H428), D18 (= D429), I19 (= I430), G20 (= G431), V24 (= V435), G60 (= G471), M61 (≠ L472), S62 (= S473), L64 (= L475), L65 (≠ I476), T66 (= T477), I91 (≠ M500), G93 (= G502), G94 (= G503), A95 (= A504)
Sites not aligning to the query:
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
30% identity, 27% coverage: 22:264/894 of query aligns to 10:238/272 of 2yckX
- binding (6s)-5,6,7,8-tetrahydrofolate: M21 (≠ T33), F22 (≠ G34), D85 (= D101), N106 (= N122), D170 (= D189), G206 (= G228), N209 (= N231), Q212 (≠ F234), K213 (≠ S235), R217 (= R243), I237 (= I263)
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
30% identity, 27% coverage: 22:264/894 of query aligns to 9:237/271 of 2ycjA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M20 (≠ T33), F21 (≠ G34), D84 (= D101), N105 (= N122), D169 (= D189), G205 (= G228), N208 (= N231), Q211 (≠ F234), R216 (= R243), I236 (= I263)
Query Sequence
>WP_057507948.1 NCBI__GCF_001431535.1:WP_057507948.1
MSTAPHTRLSGLEPLVITPDLLFINIGERTNVTGSAQFRKLVKEERYEEAVDVARQQVAS
GAQILDVNMDEGLIDSEAAMTRYLNLIMSEPDIARIPVMVDSSKWSVIEAGLKCLQGKSV
VNSISLKEGEDLFREHARKVLRYGAAAVVMAFDEAGQADTCARKVEICTRAYRILVDEIG
FPPQDIIFDPNIFAVATGIEEHDNYAVDFIEATRIIKRTLPHCHVSGGVSNVSFSFRGNE
TVRQAIHSVFLYHAIAAGMDMGIVNAGAMPIYDDLDAELRERVEDVILNRRADGTERLLE
IAERYKGSKGAARVEDLAWREKPVTDRLAHALVHGLDAWVEQDTEEARQASTRPLDVIEG
PLMNGMNVVGDLFGAGKMFLPQVVKSARVMKKAVAYLLPYIEAEKLRSGDTARSNGKIIM
ATVKGDVHDIGKNIVGVVLACNNFEVIDLGVMVPAQKILDAARAENADIIGLSGLITPSL
EEMSHVAREMQRQGFELPLMIGGATTSRAHTALKIDPHYKAPTVWVKDASRAVGVAQSLI
SHDLRAAFVAANEADYADIRLRHRNRGDAKRLVSLAHARGQRFDGGWADYVPPAPNQPGL
HVFDDYPLAELVDYIDWTPFFQAWELAGKYPAILTDEIVGSQASELYRDARQMLDRIVKE
RWLQARAVFGLWPANSVGDDVRVQHPDGEATLHFLRQQVDKPAERPDFCLADFIAPADSG
RQDWIGAFAVTAGIGIDAHVARFEAAHDDYNAILLKALADRFAEALAERLHQRVRKEFWG
HANDETLDNDALIAEKYSGIRPAPGYPACPEHSEKDTLFRLLDAQGNAGMQLTESFAMLP
TAAVSGYYFSHPQSQYFVVGRVSREQVTDYAKRKGVDRVQAERWLASNLDYDPE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory