SitesBLAST
Comparing WP_057508017.1 NCBI__GCF_001431535.1:WP_057508017.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 90% coverage: 15:418/447 of query aligns to 11:421/425 of O59010
- S65 (≠ T67) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S278) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 278:280) binding
- M311 (≠ L313) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T316) binding
- V355 (= V357) binding
- D394 (≠ S391) binding
- M395 (≠ E392) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R394) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N398) binding
- D405 (≠ N402) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 90% coverage: 15:416/447 of query aligns to 11:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L48), F46 (≠ L48), P75 (≠ H77), L91 (≠ F94), F95 (≠ L98), L130 (= L140), I133 (≠ F143), I159 (≠ V169), Y167 (≠ L177), K196 (= K198), G200 (≠ I202), I207 (= I209), F210 (= F212), L250 (≠ V252), I262 (≠ A264), M269 (≠ L271), T334 (= T336), V335 (≠ L337), G336 (= G338), T340 (≠ A342), L343 (= L345), M399 (≠ L396)
- binding aspartic acid: S277 (= S279), S278 (= S280), T314 (= T316), G354 (= G356), A358 (= A360), G359 (= G361), D394 (≠ S391), R397 (= R394), T398 (≠ S395)
- binding sodium ion: Y89 (≠ F92), T92 (≠ F95), S93 (= S96), G306 (= G308), T308 (≠ S310), N310 (= N312), N310 (= N312), M311 (≠ L313), D312 (= D314), S349 (= S351), I350 (≠ K352), T352 (≠ A354), N401 (= N398), V402 (≠ F399), D405 (≠ N402)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 89% coverage: 15:413/447 of query aligns to 2:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 89% coverage: 15:413/447 of query aligns to 8:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G71), V83 (≠ M89), I157 (≠ L170), Y164 (≠ L177), K193 (= K198), T305 (≠ S310), I306 (≠ F311), I347 (≠ K352)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L20), M199 (= M204), S275 (= S280), T311 (= T316), G356 (= G361), L384 (= L384), D391 (≠ S391), R394 (= R394)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 89% coverage: 15:414/447 of query aligns to 3:409/409 of 6bavA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 91% coverage: 15:420/447 of query aligns to 6:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K198), G195 (≠ I202), R282 (≠ E289)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S278), S272 (= S279), S273 (= S280), M307 (≠ L313), T310 (= T316), G353 (= G359), A354 (= A360), R394 (= R394), T395 (≠ S395)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 91% coverage: 15:420/447 of query aligns to 7:421/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 91% coverage: 15:420/447 of query aligns to 9:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S278), S275 (= S279), S276 (= S280), T313 (= T316), G353 (= G356), V354 (= V357), A357 (= A360), G358 (= G361), D394 (≠ S391), R397 (= R394), T398 (≠ S395)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K198), G198 (≠ I202), Y202 (≠ A206)
- binding sodium ion: Y87 (≠ F92), T90 (≠ F95), S91 (= S96), S276 (= S280), G305 (= G308), A306 (≠ Y309), T307 (≠ S310), N309 (= N312), N309 (= N312), M310 (≠ L313), D311 (= D314), S348 (= S351), I349 (≠ K352), G350 (= G353), T351 (≠ A354), N401 (= N398), V402 (≠ F399), D405 (≠ N402)
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
29% identity, 89% coverage: 15:413/447 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S280), M303 (≠ L313), T306 (= T316), A345 (= A355), G346 (= G356), V347 (= V357), G351 (= G361), D386 (≠ S391), C389 (≠ R394), T390 (≠ S395), N393 (= N398)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 91% coverage: 15:420/447 of query aligns to 9:423/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 91% coverage: 15:420/447 of query aligns to 2:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S278), S265 (= S280), M299 (≠ L313), T302 (= T316), T340 (≠ A354), G342 (= G356), V343 (= V357), G347 (= G361), D383 (≠ S391), R386 (= R394), T387 (≠ S395), N390 (= N398)
- binding decyl-beta-d-maltopyranoside: H23 (= H36), V212 (≠ L227), A216 (= A231)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
27% identity, 89% coverage: 15:413/447 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 88% coverage: 28:422/447 of query aligns to 34:407/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V81), G89 (= G82), G92 (≠ F85), A95 (= A88), V96 (≠ M89), Y99 (≠ F92), M163 (≠ V169), F167 (≠ I173), F293 (≠ L303), V297 (≠ T307)
- binding aspartic acid: S268 (= S279), S269 (= S280), T306 (= T316), G346 (= G356), I347 (≠ V357), A350 (= A360), G351 (= G361), D380 (≠ S391), R383 (= R394), T384 (≠ S395)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 88% coverage: 28:422/447 of query aligns to 26:393/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I72), S80 (≠ V81), G81 (= G82), G84 (≠ F85), Y91 (≠ F92), M156 (≠ V169), F160 (≠ I173), F286 (≠ L303), V290 (≠ T307)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I64), I148 (= I161), S262 (= S280), S263 (≠ E281), A292 (≠ Y309), T293 (≠ S310), M296 (≠ L313), T299 (= T316), G329 (= G353), A336 (= A360), G337 (= G361), D366 (≠ S391), R369 (= R394), N373 (= N398)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
29% identity, 85% coverage: 25:403/447 of query aligns to 8:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T67), L58 (≠ I68), L65 (≠ M75), V339 (≠ K352), G340 (= G353), S343 (≠ G356), I344 (≠ V357)
- binding cholesterol: W188 (≠ K205), I227 (vs. gap), F250 (= F261), W257 (≠ L271), M379 (≠ C393), S382 (≠ L396)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S280), M300 (≠ L313), T303 (= T316), Y306 (= Y319), G348 (= G361), L349 (≠ F362), M352 (≠ L365), I366 (≠ M380), L369 (≠ I383), V370 (≠ L384), D373 (= D387), D377 (≠ S391), R380 (= R394), T381 (≠ S395), N384 (= N398)
Sites not aligning to the query:
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
27% identity, 77% coverage: 67:411/447 of query aligns to 58:400/406 of 8ctcA
- binding glutamic acid: S268 (= S279), S269 (= S280), M303 (≠ L313), T306 (= T316), G346 (= G356), A350 (= A360), D380 (≠ S391), R383 (= R394)
- binding sodium ion: Y82 (≠ F92), T85 (≠ F95), T86 (≠ S96), S269 (= S280), G298 (= G308), A299 (≠ Y309), T300 (≠ S310), N302 (= N312), N302 (= N312), M303 (≠ L313), D304 (= D314), S341 (= S351), I342 (≠ K352), G343 (= G353), A344 (= A354), N387 (= N398), D391 (≠ N402)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
27% identity, 77% coverage: 67:411/447 of query aligns to 61:403/416 of 8cuaA
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
29% identity, 85% coverage: 25:403/447 of query aligns to 16:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S279), S281 (= S280), T318 (= T316), G363 (= G361), M367 (≠ L365), V385 (≠ L384), D388 (= D387), R395 (= R394), T396 (≠ S395)
- binding dodecyl beta-D-glucopyranoside: V16 (= V25), V19 (≠ I28), I20 (= I29), W389 (≠ R388)
- binding cholesterol hemisuccinate: R80 (= R83), R84 (≠ K87), I95 (≠ L98), I252 (= I248)
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
27% identity, 77% coverage: 67:411/447 of query aligns to 65:418/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S280), D398 (≠ S391), R401 (= R394), T402 (≠ S395), N405 (= N398)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (≠ T358), D398 (≠ S391), R401 (= R394), T402 (≠ S395)
- binding cholesterol hemisuccinate: I258 (≠ L243)
Sites not aligning to the query:
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
27% identity, 77% coverage: 67:411/447 of query aligns to 65:418/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S279), S287 (= S280), T324 (= T316), A358 (≠ S350), G361 (= G353), V365 (= V357), A368 (= A360), T372 (= T364), D398 (≠ S391), R401 (= R394), T402 (≠ S395), N405 (= N398)
- binding cholesterol hemisuccinate: K80 (≠ R83), R84 (≠ K87)
Query Sequence
>WP_057508017.1 NCBI__GCF_001431535.1:WP_057508017.1
MHVPAASPVPTKPLPFYRQLYFQVVVAIILGAVLGHYEPLVGEKMKPLGDAFINLVKMII
APVIFLTIVTGIAGMTHLRTVGRVFAKAMAYFMFFSTLALVVGMIVAHVVQPGAGMNINP
ADLDQTAVNSYVEKSHDLTLIGFAMDIIPKTLVSAFVDGNILQVLFVAVLFGIALALVGE
KGKPVLNFLEALVAPVFKLVHILMKAAPIGAFGAIAFTIGKYGVGSLINLAWLVGSFYLT
AFLFVVVILGAVARLCGFSVFKLARYLKAELLLVLGTSSSESALPSLMEKMERAGCSKSV
VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLLVAMLSSKGAAGVTGA
GFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWEGALDRDR
LKLALDGRESELPPPVDAALPLASAKI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory