SitesBLAST
Comparing WP_057508080.1 NCBI__GCF_001431535.1:WP_057508080.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
56% identity, 100% coverage: 2:612/612 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W77), N98 (= N101), G99 (= G102), Y248 (= Y251), E481 (= E485), K485 (= K489), E488 (= E492), H504 (= H508), K603 (= K607)
- binding fructose -6-phosphate: G301 (= G304), T302 (= T305), S303 (= S306), S347 (= S350), Q348 (= Q351), S349 (= S352), T352 (= T355), S401 (= S404), K485 (= K489), E488 (= E492)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
56% identity, 100% coverage: 2:612/612 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W77), N98 (= N101), G99 (= G102), Y248 (= Y251), E481 (= E485), K485 (= K489), E488 (= E492), H504 (= H508), K603 (= K607)
- binding glucose-6-phosphate: T302 (= T305), S303 (= S306), S347 (= S350), Q348 (= Q351), S349 (= S352), T352 (= T355), S401 (= S404), K485 (= K489), E488 (= E492)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
56% identity, 100% coverage: 2:612/612 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W77), N98 (= N101), G99 (= G102), Y248 (= Y251), E481 (= E485), K485 (= K489), E488 (= E492), H504 (= H508), K603 (= K607)
- binding glucose-6-phosphate: T302 (= T305), S347 (= S350), Q348 (= Q351), S349 (= S352), T352 (= T355), V399 (= V402), S401 (= S404), E488 (= E492)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R76), W74 (= W77), T76 (= T79), H86 (= H89), N98 (= N101), G99 (= G102), D123 (= D126)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
59% identity, 59% coverage: 249:612/612 of query aligns to 5:367/367 of 1mosA
- active site: E240 (= E485), K244 (= K489), E247 (= E492), H263 (= H508), K362 (= K607)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T305), S62 (= S306), S106 (= S350), Q107 (= Q351), S108 (= S352), T111 (= T355), K244 (= K489), E247 (= E492)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
59% identity, 59% coverage: 249:612/612 of query aligns to 4:366/366 of 1morA
- active site: E239 (= E485), K243 (= K489), E246 (= E492), H262 (= H508), K361 (= K607)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T305), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V157 (= V402), A360 (= A606), K361 (= K607)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
59% identity, 59% coverage: 249:612/612 of query aligns to 4:366/366 of 1moqA
- active site: E239 (= E485), K243 (= K489), E246 (= E492), H262 (= H508), K361 (= K607)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T305), S61 (= S306), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V157 (= V402), A360 (= A606), K361 (= K607)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
58% identity, 58% coverage: 249:603/612 of query aligns to 4:357/357 of 7dnrA
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
37% identity, 100% coverage: 2:612/612 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W77), N122 (= N101), G123 (= G102), E536 (= E485), K540 (= K489), E543 (= E492), H559 (= H508), K658 (= K607)
- binding glucose-6-phosphate: T358 (= T305), S359 (= S306), S403 (= S350), Q404 (= Q351), S405 (= S352), T408 (= T355), S456 (= S404), K540 (= K489), E543 (= E492)
- binding glutamic acid: C1 (= C2), R94 (= R76), W95 (= W77), T97 (= T79), G123 (= G102), D147 (= D126)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
37% identity, 100% coverage: 2:612/612 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W77), N122 (= N101), G123 (= G102), E533 (= E485), K537 (= K489), E540 (= E492), H556 (= H508), K655 (= K607)
- binding glucose-6-phosphate: C353 (= C303), T355 (= T305), S356 (= S306), S400 (= S350), Q401 (= Q351), S402 (= S352), T405 (= T355), S453 (= S404), K537 (= K489), E540 (= E492)
- binding glutamic acid: C1 (= C2), R94 (= R76), W95 (= W77), T97 (= T79), H107 (= H89), G123 (= G102), D147 (= D126)
- binding magnesium ion: S434 (≠ P385), R435 (= R386), T437 (≠ S388)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ D240), R322 (≠ A273), G334 (= G285), G424 (≠ S375), T426 (≠ C377), S434 (≠ P385), T437 (≠ S388), C439 (≠ L390), G440 (≠ V391), V441 (≠ C392), H442 (≠ Y393)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
36% identity, 99% coverage: 2:605/612 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ I8), R32 (= R27), W95 (= W77), N122 (= N101), G123 (= G102), E532 (= E485), K536 (= K489), E539 (= E492), H555 (= H508)
- binding glucose-6-phosphate: G353 (= G304), T354 (= T305), S355 (= S306), S399 (= S350), Q400 (= Q351), S401 (= S352), T404 (= T355), S452 (= S404), E539 (= E492)
- binding magnesium ion: S433 (≠ P385), R434 (= R386), T436 (≠ S388)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ D240), R321 (≠ A273), G333 (= G285), G423 (≠ S375), T425 (≠ C377), S433 (≠ P385), T436 (≠ S388), C438 (≠ L390), G439 (≠ V391), V440 (≠ C392), H441 (≠ Y393)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
35% identity, 100% coverage: 1:612/612 of query aligns to 1:699/699 of Q06210
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 69% coverage: 189:612/612 of query aligns to 287:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
40% identity, 59% coverage: 249:612/612 of query aligns to 3:365/365 of 2zj4A
- active site: E238 (= E485), K242 (= K489), E245 (= E492), H261 (= H508), K360 (= K607)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T305), S61 (= S306), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V156 (= V402), A157 (= A403), K242 (= K489), E245 (= E492)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
40% identity, 59% coverage: 249:612/612 of query aligns to 3:365/365 of 2zj3A
- active site: E238 (= E485), K242 (= K489), E245 (= E492), H261 (= H508), K360 (= K607)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T305), S61 (= S306), S105 (= S350), Q106 (= Q351), S107 (= S352), T110 (= T355), V156 (= V402), A359 (= A606), K360 (= K607)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
53% identity, 38% coverage: 2:234/612 of query aligns to 1:231/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W77), N98 (= N101), G99 (= G102)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R76), W74 (= W77), T76 (= T79), H86 (= H89), N98 (= N101), G99 (= G102), D123 (= D126)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
53% identity, 38% coverage: 2:234/612 of query aligns to 1:231/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W77), N98 (= N101), G99 (= G102)
- binding glutamic acid: C1 (= C2), R73 (= R76), W74 (= W77), T76 (= T79), H86 (= H89), N98 (= N101), G99 (= G102), D123 (= D126)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
38% identity, 58% coverage: 249:600/612 of query aligns to 2:352/352 of 2v4mA
- active site: E237 (= E485), K241 (= K489), E244 (= E492), H260 (= H508)
- binding fructose -6-phosphate: T59 (= T305), S60 (= S306), S104 (= S350), Q105 (= Q351), S106 (= S352), T109 (= T355), A156 (= A403), S157 (= S404), K241 (= K489), E244 (= E492)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
37% identity, 57% coverage: 250:600/612 of query aligns to 1:352/352 of 2pocB
- active site: E236 (= E485), K240 (= K489), E243 (= E492), H259 (= H508)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C303), T57 (= T305), S58 (= S306), S102 (= S350), Q103 (= Q351), S104 (= S352), T107 (= T355), E243 (= E492)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ A273), G36 (= G285), G126 (≠ S375), V128 (≠ C377), S136 (≠ P385), T139 (≠ S388), C141 (≠ L390), G142 (≠ V391), V143 (≠ C392), H144 (≠ Y393)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
34% identity, 57% coverage: 250:600/612 of query aligns to 1:339/339 of 2putA
- active site: E236 (= E485), K240 (= K489), E243 (= E492)
- binding fructose -6-phosphate: C55 (= C303), T57 (= T305), S102 (= S350), Q103 (= Q351), S104 (= S352), T107 (= T355), A154 (= A403), S155 (= S404), K240 (= K489)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ A273), G36 (= G285), G126 (≠ S375), V128 (≠ C377), S136 (≠ P385), T139 (≠ S388), C141 (≠ L390), G142 (≠ V391), V143 (≠ C392), H144 (≠ Y393)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
34% identity, 58% coverage: 249:600/612 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E485), K241 (= K489), E244 (= E492)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C303), T58 (= T305), S103 (= S350), Q104 (= Q351), S105 (= S352), T108 (= T355), A155 (= A403), E244 (= E492)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (≠ A273), G37 (= G285), G127 (≠ S375), V129 (≠ C377), S137 (≠ P385), T140 (≠ S388), C142 (≠ L390), G143 (≠ V391), V144 (≠ C392), H145 (≠ Y393)
Query Sequence
>WP_057508080.1 NCBI__GCF_001431535.1:WP_057508080.1
MCGIVGAIADRDVVPVLIEGLKRLEYRGYDSSGIAVLEQGAQPDIRRVRRTGRVSEMASA
ADAEGFNSVLGIGHTRWATHGGVTEANAHPHISAGVALVHNGIIENHEEQREKLRALGYV
FESQTDTEVIAHLMHHHLKGGDSLLSALQRTVKELTGAYALAVMSRAEPDHFVCARMGCP
LLVGLGDGENFVASDVSAIISSTRRVIFLEEGDTADVRRDGVQVYDAHDQPIDRGVHLSD
VSLASLELGPYRHFMQKEVHEQPRALGDTIEAAIDAGGFPAELFGRNAEAVLSGITGVQI
LACGTSYYAGMTARYWIESIAGLPCNVEIASEYRYRAAYADPKHLVVTLSQSGETLDTME
ALKYAKSLGHLHTLSICNVPESAIPRASELVCYTRAGAEIGVASTKAFTTQLAALFQLTV
VLGKLHGRVDATREADYLEQLRFLPGSVQHALNMEPQIAAWAERFARKSSALFLGRGLHY
PIALEGALKLKEITYIHAEAYPAGELKHGPLALVDEDMPVVVIAPNDSLLEKVKSNMQEV
RARGGELFVFADQDSNFVESEGVHVIRTPRHAGVLSPIVHTIPVQLLAYHTALARGTDVD
KPRNLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory