SitesBLAST
Comparing WP_057508164.1 NCBI__GCF_001431535.1:WP_057508164.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xkmA Crystal structure of xylose isomerase from an human intestinal tract microbe bacteroides thetaiotaomicron
61% identity, 97% coverage: 10:443/446 of query aligns to 1:434/435 of 4xkmA
- active site: F23 (≠ Y32), E29 (≠ D38), H100 (= H109), D103 (= D112), W138 (= W147), E231 (= E240), K233 (= K242), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
- binding manganese (ii) ion: E231 (= E240), E267 (= E276), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
5nhcA Crystal structure of xylose isomerase from piromyces e2 in complex with two co2+ ions and xylulose (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nhcA
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding cobalt (ii) ion: E232 (= E240), E268 (= E276), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding 4-hydroxyproline: G290 (= G298), L292 (= L300), G328 (≠ Q336), G330 (= G338), V332 (≠ G340)
- binding d-xylulose: W49 (= W57), H101 (= H109), W188 (= W196), E232 (= E240), E268 (= E276), H271 (= H279), D339 (= D347)
5nhaA Crystal structure of xylose isomerase from piromyces sp. E2 in complex with two mn2+ ions and sorbitol (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nhaA
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding manganese (ii) ion: E232 (= E240), E268 (= E276), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding sorbitol: W49 (= W57), H101 (= H109), W188 (= W196), E232 (= E240), D339 (= D347)
5nh9A Crystal structure of xylose isomerase from piromyces e2 in complex with two mn2+ ions and xylose (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nh9A
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding manganese (ii) ion: E232 (= E240), E268 (= E276), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding D-xylose: W49 (= W57), H101 (= H109), W188 (= W196), E232 (= E240), E268 (= E276), H271 (= H279), D339 (= D347)
- binding beta-D-xylopyranose: G63 (= G71), K65 (≠ R73), S66 (≠ V74), K203 (= K211), K206 (≠ Q214), H257 (= H265), D288 (= D296), A289 (= A297)
5nh7A Crystal structure of xylose isomerase from piromyces e2 in complex with two mg2+ ions and xylose (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nh7A
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding magnesium ion: E232 (= E240), E268 (= E276), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding D-xylose: W49 (= W57), H101 (= H109), W188 (= W196), E232 (= E240), E268 (= E276), H271 (= H279), D339 (= D347)
- binding beta-D-xylopyranose: G63 (= G71), K65 (≠ R73), S66 (≠ V74)
- binding alpha-D-xylopyranose: P21 (= P29), D40 (≠ E48), Y97 (= Y105), K136 (= K144), E350 (≠ Q358)
5nh6A Crystal structure of xylose isomerase from piromyces e2 complexed with one mg2+ ion and xylitol (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nh6A
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding magnesium ion: E232 (= E240), E268 (= E276), D296 (= D304), D339 (= D347)
- binding Xylitol: W49 (= W57), H101 (= H109), W188 (= W196), E232 (= E240), E268 (= E276), H271 (= H279), D339 (= D347)
5nh5A Crystal structure of native xylose isomerase from piromyces e2 (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nh5A
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding calcium ion: E232 (= E240), E268 (= E276), D296 (= D304), D339 (= D347)
- binding fe (ii) ion: E232 (= E240), E268 (= E276), D296 (= D304), D339 (= D347)
- binding magnesium ion: E232 (= E240), E268 (= E276), D296 (= D304), D339 (= D347)
5nh4A Crystal structure of xylose isomerase from piromyces e2 in complex with one mg2+ ions and glycerol (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 2:435/436 of 5nh4A
- active site: H101 (= H109), D104 (= D112), W139 (= W147), E232 (= E240), K234 (= K242), E268 (= E276), H271 (= H279), D296 (= D304), D307 (= D315), D309 (= D317), D339 (= D347)
- binding magnesium ion: E232 (= E240), E268 (= E276), D296 (= D304), D339 (= D347)
5yn3A Crystal structure of xylose isomerase from piromyces sp. E2 (see paper)
58% identity, 97% coverage: 10:443/446 of query aligns to 1:434/435 of 5yn3A
- active site: H100 (= H109), D103 (= D112), W138 (= W147), E231 (= E240), K233 (= K242), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
- binding glycerol: H100 (= H109), W187 (= W196), E231 (= E240), D295 (= D304)
- binding manganese (ii) ion: E231 (= E240), E267 (= E276), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
1a0eA Xylose isomerase from thermotoga neapolitana
53% identity, 98% coverage: 11:446/446 of query aligns to 2:437/443 of 1a0eA
- active site: H100 (= H109), D103 (= D112), W138 (= W147), E231 (= E240), K233 (= K242), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
- binding cobalt (ii) ion: E231 (= E240), E267 (= E276), E267 (= E276), H270 (= H279), D295 (= D304), D308 (= D317), D338 (= D347)
P00944 Xylose isomerase; D-xylulose keto-isomerase; EC 5.3.1.5 from Escherichia coli (strain K12) (see paper)
52% identity, 97% coverage: 12:445/446 of query aligns to 4:438/440 of P00944
- H101 (= H109) active site
1a0dA Xylose isomerase from bacillus stearothermophilus
53% identity, 98% coverage: 12:446/446 of query aligns to 2:435/437 of 1a0dA
- active site: H98 (= H109), D101 (= D112), W136 (= W147), E229 (= E240), K231 (= K242), E265 (= E276), H268 (= H279), D293 (= D304), D304 (= D315), D306 (= D317), D336 (= D347)
- binding manganese (ii) ion: E229 (= E240), E265 (= E276), E265 (= E276), H268 (= H279), D293 (= D304), D304 (= D315), D306 (= D317), D336 (= D347)
1a0cA Xylose isomerase from thermoanaerobacterium thermosulfurigenes
51% identity, 98% coverage: 11:445/446 of query aligns to 2:436/437 of 1a0cA
- active site: H100 (= H109), D103 (= D112), W138 (= W147), E231 (= E240), K233 (= K242), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
- binding cobalt (ii) ion: E231 (= E240), E267 (= E276), E267 (= E276), H270 (= H279), D295 (= D304), D306 (= D315), D308 (= D317), D338 (= D347)
6intA Xylose isomerase from paenibacillus sp. R4 (see paper)
49% identity, 97% coverage: 12:445/446 of query aligns to 1:411/413 of 6intA
- active site: H74 (= H109), D77 (= D112), W112 (= W147), E205 (= E240), K207 (= K242), E241 (= E276), H244 (= H279), D269 (= D304), D280 (= D315), D282 (= D317), D313 (= D347)
- binding calcium ion: G166 (= G201), E178 (= E213), E205 (= E240), E241 (= E276), E241 (= E276), H244 (= H279), D269 (= D304), D280 (= D315), D282 (= D317), D313 (= D347)
1clkA Crystal structure of streptomyces diastaticus no.7 strain m1033 xylose isomerase at 1.9 a resolution with pseudo-i222 space group (see paper)
30% identity, 68% coverage: 51:352/446 of query aligns to 9:291/387 of 1clkA
- active site: H53 (= H109), D56 (= D112), M87 (≠ W147), E180 (= E240), K182 (= K242), E216 (= E276), H219 (= H279), D244 (= D304), D254 (= D317), D256 (vs. gap), D286 (= D347)
- binding cobalt (ii) ion: E216 (= E276), H219 (= H279), D254 (= D317), D256 (vs. gap)
- binding magnesium ion: E180 (= E240), E216 (= E276), D244 (= D304), D286 (= D347)
1xiiA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
29% identity, 60% coverage: 51:318/446 of query aligns to 8:254/385 of 1xiiA
- active site: H52 (= H109), D55 (= D112), M86 (≠ W147), E179 (= E240), K181 (= K242), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding manganese (ii) ion: E179 (= E240), E215 (= E276), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding d-xylulose: W14 (= W57), H52 (= H109), W135 (= W196), E179 (= E240), H218 (= H279)
Sites not aligning to the query:
1xihA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
29% identity, 60% coverage: 51:318/446 of query aligns to 8:254/385 of 1xihA
- active site: H52 (= H109), D55 (= D112), M86 (≠ W147), E179 (= E240), K181 (= K242), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding manganese (ii) ion: E179 (= E240), E215 (= E276), D243 (= D304)
- binding sorbitol: H52 (= H109), T88 (= T149), V133 (= V194), W135 (= W196), E179 (= E240), K181 (= K242), E215 (= E276), H218 (= H279)
Sites not aligning to the query:
1xicA Modes of binding substrates and their analogues to the enzyme d-xylose isomerase (see paper)
29% identity, 60% coverage: 51:318/446 of query aligns to 8:254/385 of 1xicA
- active site: H52 (= H109), D55 (= D112), M86 (≠ W147), E179 (= E240), K181 (= K242), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding manganese (ii) ion: E179 (= E240), E215 (= E276), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding D-xylose: W14 (= W57), H52 (= H109), W135 (= W196), E179 (= E240), H218 (= H279)
Sites not aligning to the query:
1gw9A Tri-iodide derivative of xylose isomerase from streptomyces rubiginosus (see paper)
29% identity, 60% coverage: 51:318/446 of query aligns to 8:254/384 of 1gw9A
- active site: H52 (= H109), D55 (= D112), M86 (≠ W147), E179 (= E240), K181 (= K242), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding calcium ion: E179 (= E240), E215 (= E276), E215 (= E276), H218 (= H279), D243 (= D304), D253 (= D317)
- binding beta-L-xylopyranose: H52 (= H109), F92 (= F153), W135 (= W196), E179 (= E240)
Sites not aligning to the query:
9xiaA X-ray analysis of d-xylose isomerase at 1.9 angstroms: native enzyme in complex with substrate and with a mechanism-designed inactivator (see paper)
29% identity, 60% coverage: 51:318/446 of query aligns to 10:256/387 of 9xiaA
- active site: H54 (= H109), D57 (= D112), M88 (≠ W147), E181 (= E240), K183 (= K242), E217 (= E276), H220 (= H279), D245 (= D304), D255 (= D317)
- binding 3-deoxy-3-methyl-beta-D-fructofuranose: W16 (= W57), H54 (= H109), M88 (≠ W147), T90 (= T149), V135 (= V194), W137 (= W196), E181 (= E240), D245 (= D304)
- binding manganese (ii) ion: E181 (= E240), E217 (= E276), E217 (= E276), H220 (= H279), D245 (= D304), D255 (= D317)
Sites not aligning to the query:
Query Sequence
>WP_057508164.1 NCBI__GCF_001431535.1:WP_057508164.1
MSSSFYVGQREFFPGVGRIPFEGRDSDNPLAYKVYDADKQIGGRSMAEHLRFAVAYWHSF
CGAGHDPFGPGTRVYPWDQGATPLARAEAKADAAFEFVTKLGVPYYCFHDVDLAPDADDI
GEYRANLGHMVEIAGERQRQTGVKLLWGTANLFSHPRYMNGAATNPDFAVVARAAVQVRA
ALDATVALGGSNYVFWGGREGYACLLNTDMKREQAHLARFLAAARDYGRSIGFTGTFLIE
PKPMEPMHHQYDFDSATVVGFLRAHGLDRDFKLNIEANHATLSGHTFAHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDAVGAMLVVLRQGGFGDGGLNFDAKVRRESSDPQDL
FIAHIGGMDTFARGLEVAHALVTASPLEQWRSERYASFDSGAGAAFANGQLTLQDLCAHA
QQAGEPRQRSGRQEAYENLLNQYLLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory