Comparing WP_057508177.1 NCBI__GCF_001431535.1:WP_057508177.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 69% coverage: 44:232/275 of query aligns to 44:237/271 of Q9M8S8
5dw8A Crystal structure of 2'amp bound saimpase-ii
27% identity, 86% coverage: 16:252/275 of query aligns to 9:234/260 of 5dw8A
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 89% coverage: 16:261/275 of query aligns to 92:335/346 of Q6NPM8
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
25% identity, 84% coverage: 15:245/275 of query aligns to 13:248/277 of P29218
6giuA Human impase with l-690330 (see paper)
25% identity, 84% coverage: 15:245/275 of query aligns to 11:246/275 of 6giuA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
25% identity, 84% coverage: 15:245/275 of query aligns to 9:244/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
25% identity, 84% coverage: 15:245/275 of query aligns to 9:244/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
25% identity, 84% coverage: 15:245/275 of query aligns to 9:244/272 of 1awbA
6zk0AAA human impase with ebselen (see paper)
25% identity, 84% coverage: 15:245/275 of query aligns to 10:245/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
25% identity, 84% coverage: 15:245/275 of query aligns to 11:246/274 of 4as4A
5j16A Crystal structure of inositol monophosphate bound saimpase-ii
28% identity, 76% coverage: 45:252/275 of query aligns to 26:230/258 of 5j16A
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
25% identity, 84% coverage: 15:245/275 of query aligns to 9:244/266 of 1imdA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
32% identity, 78% coverage: 20:233/275 of query aligns to 12:228/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
33% identity, 72% coverage: 35:233/275 of query aligns to 28:227/255 of 5yhtA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 72% coverage: 35:233/275 of query aligns to 31:230/260 of P95189
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
24% identity, 84% coverage: 15:245/275 of query aligns to 13:248/277 of O55023
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
24% identity, 84% coverage: 15:245/275 of query aligns to 11:246/274 of 4as5A
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
27% identity, 81% coverage: 38:261/275 of query aligns to 34:249/262 of 2qflA
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
27% identity, 81% coverage: 38:261/275 of query aligns to 34:249/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
27% identity, 81% coverage: 38:261/275 of query aligns to 38:253/270 of 6ib8B
>WP_057508177.1 NCBI__GCF_001431535.1:WP_057508177.1
MTHARLTTDLRETVIAIAQDAAAAIMQVYASGFDITLKADDSPVTAADLAAHQRIVSGLS
RLTPDLPILSEEATAAAWETRRHWGAYWLVDPLDGTREFIKRNGEFSVNIALVYQGAPTF
GVVLAPVTGLVWHAMRGEQAYRRQGAHDTVLRTRVPAQSPLRVAASRSHRSARTQALLDR
MGDIETVAQGSSLKFCRIAEGDLDVYPRLGPTSEWDTAAGQCVLHAAGGAVLSTATGKPF
RYNRRESLLNGDFMALGDTRLAWRDWLPPDEPETA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory