SitesBLAST
Comparing WP_057508212.1 NCBI__GCF_001431535.1:WP_057508212.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tkkA The structure of a substrate-liganded complex of the l-ala-d/l-glu epimerase from bacillus subtilis (see paper)
51% identity, 97% coverage: 1:354/364 of query aligns to 1:354/359 of 1tkkA
- active site: F19 (= F19), P50 (≠ A50), V53 (= V53), T135 (= T135), K160 (= K160), K162 (= K162), L190 (= L189), D191 (= D190), A192 (= A191), N193 (= N192), E219 (= E218), D244 (= D243), E245 (= E244), S246 (= S245), N266 (= N265), K268 (= K267), G295 (= G294), S296 (≠ C295), M297 (= M296), F320 (≠ V320), D321 (= D321), F322 (≠ L322)
- binding alanine: K160 (= K160), K162 (= K162), D321 (= D321), D323 (= D323)
- binding glutamic acid: F19 (= F19), R24 (= R24), K160 (= K160), D191 (= D190), K268 (= K267), S296 (≠ C295), M297 (= M296), I298 (= I297)
- binding magnesium ion: D191 (= D190), E219 (= E218), D244 (= D243)
1jpmA L-ala-d/l-glu epimerase (see paper)
51% identity, 97% coverage: 1:354/364 of query aligns to 1:354/359 of 1jpmA
- active site: F19 (= F19), P50 (≠ A50), V53 (= V53), T135 (= T135), K160 (= K160), K162 (= K162), L190 (= L189), D191 (= D190), A192 (= A191), N193 (= N192), E219 (= E218), D244 (= D243), E245 (= E244), S246 (= S245), N266 (= N265), K268 (= K267), G295 (= G294), S296 (≠ C295), M297 (= M296), F320 (≠ V320), D321 (= D321), F322 (≠ L322)
- binding magnesium ion: D191 (= D190), E219 (= E218), D244 (= D243)
O34508 L-Ala-D/L-Glu epimerase; AE epimerase; AEE; EC 5.1.1.20 from Bacillus subtilis (strain 168) (see 2 papers)
51% identity, 97% coverage: 1:354/364 of query aligns to 1:354/366 of O34508
- R24 (= R24) binding
- T135 (= T135) binding
- K160 (= K160) binding
- K162 (= K162) active site, Proton acceptor; specific for (R)-substrate epimerization
- D191 (= D190) binding
- E219 (= E218) binding
- D244 (= D243) binding
- K268 (= K267) active site, Proton acceptor; specific for (S)-substrate epimerization
- S296 (≠ C295) binding
- I298 (= I297) binding
- D321 (= D321) binding
- D323 (= D323) binding
3jzuA Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-leu-l-tyr (see paper)
42% identity, 98% coverage: 1:355/364 of query aligns to 1:353/353 of 3jzuA
- active site: F19 (= F19), P50 (≠ A50), F53 (≠ V53), T134 (= T135), K159 (= K160), K161 (= K162), D189 (= D190), N191 (= N192), E215 (= E218), D240 (= D243), E241 (= E244), S242 (= S245), N262 (= N265), K264 (= K267), G291 (= G294), C292 (= C295), M293 (= M296), A317 (≠ V320), D318 (= D321), L319 (= L322)
- binding leucine: K161 (= K162), C292 (= C295), D318 (= D321), D320 (= D323), A321 (≠ G324)
- binding magnesium ion: D189 (= D190), E215 (= E218), D240 (= D243)
- binding tyrosine: I21 (≠ T21), I26 (≠ V26), F53 (≠ V53), K161 (= K162), N191 (= N192), D240 (= D243), K264 (= K267), M293 (= M296), A294 (≠ I297), E295 (vs. gap)
3jw7A Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ile-l-tyr (see paper)
42% identity, 98% coverage: 1:355/364 of query aligns to 1:353/353 of 3jw7A
- active site: F19 (= F19), P50 (≠ A50), F53 (≠ V53), T134 (= T135), K159 (= K160), K161 (= K162), D189 (= D190), N191 (= N192), E215 (= E218), D240 (= D243), E241 (= E244), S242 (= S245), N262 (= N265), K264 (= K267), G291 (= G294), C292 (= C295), M293 (= M296), A317 (≠ V320), D318 (= D321), L319 (= L322)
- binding isoleucine: K161 (= K162), C292 (= C295), D318 (= D321), D320 (= D323)
- binding magnesium ion: D189 (= D190), E215 (= E218), D240 (= D243)
- binding tyrosine: F53 (≠ V53), I54 (= I54), K161 (= K162), D240 (= D243), K264 (= K267), C292 (= C295), A294 (≠ I297), E295 (vs. gap)
3kumA Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-arg-l-tyr (see paper)
41% identity, 98% coverage: 1:355/364 of query aligns to 1:353/354 of 3kumA
- active site: F19 (= F19), P50 (≠ A50), F53 (≠ V53), T134 (= T135), K159 (= K160), K161 (= K162), D189 (= D190), N191 (= N192), E215 (= E218), D240 (= D243), E241 (= E244), S242 (= S245), N262 (= N265), K264 (= K267), G291 (= G294), C292 (= C295), M293 (= M296), A317 (≠ V320), D318 (= D321), L319 (= L322)
- binding arginine: F19 (= F19), K161 (= K162), C292 (= C295), D318 (= D321), D320 (= D323)
- binding magnesium ion: D189 (= D190), E215 (= E218), D240 (= D243)
- binding tyrosine: I21 (≠ T21), F53 (≠ V53), I54 (= I54), K161 (= K162), D240 (= D243), K264 (= K267), A294 (≠ I297), E295 (= E298)
3k1gA Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ser-l-tyr (see paper)
41% identity, 98% coverage: 1:355/364 of query aligns to 1:353/354 of 3k1gA
- active site: F19 (= F19), P50 (≠ A50), F53 (≠ V53), T134 (= T135), K159 (= K160), K161 (= K162), D189 (= D190), N191 (= N192), E215 (= E218), D240 (= D243), E241 (= E244), S242 (= S245), N262 (= N265), K264 (= K267), G291 (= G294), C292 (= C295), M293 (= M296), A317 (≠ V320), D318 (= D321), L319 (= L322)
- binding magnesium ion: D189 (= D190), E215 (= E218), D240 (= D243)
- binding serine: F19 (= F19), K161 (= K162), C292 (= C295), D318 (= D321), D320 (= D323)
- binding tyrosine: I21 (≠ T21), F53 (≠ V53), K161 (= K162), D189 (= D190), D240 (= D243), K264 (= K267), C292 (= C295), A294 (≠ I297), E295 (= E298)
3jvaB Crystal structure of dipeptide epimerase from enterococcus faecalis v583 (see paper)
41% identity, 98% coverage: 1:355/364 of query aligns to 1:353/354 of 3jvaB
- active site: F19 (= F19), P50 (≠ A50), F53 (≠ V53), T134 (= T135), K159 (= K160), K161 (= K162), D189 (= D190), N191 (= N192), E215 (= E218), D240 (= D243), E241 (= E244), S242 (= S245), N262 (= N265), K264 (= K267), G291 (= G294), C292 (= C295), M293 (= M296), A317 (≠ V320), D318 (= D321), L319 (= L322)
- binding magnesium ion: D189 (= D190), E215 (= E218), D240 (= D243)
3r1zA Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : complex with l- ala-l-glu and l-ala-d-glu (see paper)
34% identity, 99% coverage: 2:360/364 of query aligns to 3:360/362 of 3r1zA
- active site: F20 (= F19), A51 (= A50), A54 (≠ V53), S136 (≠ T135), K161 (= K160), K163 (= K162), D191 (= D190), N193 (= N192), E219 (= E218), D244 (= D243), E245 (= E244), S246 (= S245), K268 (= K267), G295 (= G294), C296 (= C295), M297 (= M296), D320 (= D321)
- binding alanine: S136 (≠ T135), K163 (= K162), C296 (= C295), D320 (= D321), D322 (= D323)
- binding glutamic acid: R25 (= R24), T52 (= T51), K163 (= K162), K268 (= K267), C296 (= C295), M297 (= M296), M298 (≠ I297)
3r0uA Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate and mg complex (see paper)
34% identity, 99% coverage: 2:360/364 of query aligns to 3:360/362 of 3r0uA
- active site: F20 (= F19), A51 (= A50), A54 (≠ V53), S136 (≠ T135), K161 (= K160), K163 (= K162), D191 (= D190), N193 (= N192), E219 (= E218), D244 (= D243), E245 (= E244), S246 (= S245), K268 (= K267), G295 (= G294), C296 (= C295), M297 (= M296), D320 (= D321)
- binding magnesium ion: D191 (= D190), E219 (= E218), T234 (= T233), S237 (≠ V236), D244 (= D243)
3r1zB Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : complex with l- ala-l-glu and l-ala-d-glu (see paper)
34% identity, 99% coverage: 2:360/364 of query aligns to 3:360/364 of 3r1zB
- active site: F20 (= F19), A51 (= A50), A54 (≠ V53), S136 (≠ T135), K161 (= K160), K163 (= K162), D191 (= D190), N193 (= N192), E219 (= E218), D244 (= D243), E245 (= E244), S246 (= S245), K268 (= K267), G295 (= G294), C296 (= C295), M297 (= M296), D320 (= D321)
- binding alanine: S136 (≠ T135), K163 (= K162), C296 (= C295), D320 (= D321), D322 (= D323)
- binding d-glutamic acid: F20 (= F19), R25 (= R24), I55 (= I54), K163 (= K162), D191 (= D190), D244 (= D243), K268 (= K267), M297 (= M296), M298 (≠ I297)
3r11B Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg and fumarate complex (see paper)
34% identity, 99% coverage: 2:360/364 of query aligns to 3:360/364 of 3r11B
- active site: F20 (= F19), A51 (= A50), A54 (≠ V53), S136 (≠ T135), K161 (= K160), K163 (= K162), D191 (= D190), N193 (= N192), E219 (= E218), D244 (= D243), E245 (= E244), S246 (= S245), K268 (= K267), G295 (= G294), C296 (= C295), M297 (= M296), D320 (= D321)
- binding fumaric acid: F20 (= F19), R25 (= R24), I55 (= I54), K163 (= K162), K268 (= K267), M297 (= M296), M298 (≠ I297)
2p8cA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl arg. (see paper)
33% identity, 97% coverage: 1:354/364 of query aligns to 1:351/369 of 2p8cA
- active site: F19 (= F19), A50 (= A50), H53 (≠ V53), V136 (≠ I134), F160 (≠ L159), K161 (= K160), M162 (≠ I161), K163 (= K162), D191 (= D190), N193 (= N192), E218 (= E218), D243 (= D243), E244 (= E244), G245 (≠ S245), N265 (= N265), K267 (= K267), G294 (= G294), S295 (≠ C295), M296 (= M296), V319 (= V320), E320 (≠ D321), L321 (= L322)
- binding magnesium ion: D191 (= D190), E218 (= E218), D243 (= D243)
- binding n~2~-(3-carboxypropanoyl)-l-arginine: F19 (= F19), Y26 (≠ V26), M29 (≠ V29), D51 (≠ T51), K163 (= K162), D191 (= D190), D243 (= D243), K267 (= K267), S295 (≠ C295), M296 (= M296), E320 (≠ D321), L321 (= L322), T322 (≠ D323)
2p8bA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl lys. (see paper)
33% identity, 97% coverage: 1:354/364 of query aligns to 1:351/369 of 2p8bA
- active site: F19 (= F19), A50 (= A50), H53 (≠ V53), V136 (≠ I134), F160 (≠ L159), K161 (= K160), M162 (≠ I161), K163 (= K162), D191 (= D190), N193 (= N192), E218 (= E218), D243 (= D243), E244 (= E244), G245 (≠ S245), N265 (= N265), K267 (= K267), G294 (= G294), S295 (≠ C295), M296 (= M296), V319 (= V320), E320 (≠ D321), L321 (= L322)
- binding magnesium ion: D191 (= D190), E218 (= E218), D243 (= D243)
- binding n-succinyl lysine: F19 (= F19), Y26 (≠ V26), D51 (≠ T51), V136 (≠ I134), K161 (= K160), K163 (= K162), D243 (= D243), K267 (= K267), S295 (≠ C295), M296 (= M296), E320 (≠ D321), L321 (= L322), T322 (≠ D323)
2p88A Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 (see paper)
33% identity, 97% coverage: 1:354/364 of query aligns to 1:351/369 of 2p88A
- active site: F19 (= F19), A50 (= A50), H53 (≠ V53), V136 (≠ I134), F160 (≠ L159), K161 (= K160), M162 (≠ I161), K163 (= K162), D191 (= D190), N193 (= N192), E218 (= E218), D243 (= D243), E244 (= E244), G245 (≠ S245), N265 (= N265), K267 (= K267), G294 (= G294), S295 (≠ C295), M296 (= M296), V319 (= V320), E320 (≠ D321), L321 (= L322)
- binding magnesium ion: D191 (= D190), E218 (= E218), D243 (= D243)
Q81IL5 N-succinyl-L-Arg/Lys racemase; N-succinyl amino acid racemase; NSAR; EC 5.1.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see paper)
33% identity, 97% coverage: 1:354/364 of query aligns to 1:351/369 of Q81IL5
- D191 (= D190) binding
- E218 (= E218) binding
- D243 (= D243) binding
3q4dA Crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-ala (see paper)
36% identity, 97% coverage: 1:353/364 of query aligns to 1:351/368 of 3q4dA
- active site: F19 (= F19), P50 (≠ A50), T53 (≠ V53), T135 (= T135), K160 (= K160), K162 (= K162), D190 (= D190), N192 (= N192), E216 (= E218), D241 (= D243), E242 (= E244), S243 (= S245), K265 (= K267), G292 (= G294), G293 (≠ C295), F294 (≠ M296), Y317 (≠ V320), D318 (= D321), F319 (≠ L322)
- binding alanine: K162 (= K162), K265 (= K267), G293 (≠ C295)
- binding d-alanine: F19 (= F19), K162 (= K162), G293 (≠ C295), D318 (= D321), D320 (= D323), T321 (≠ G324)
- binding magnesium ion: D190 (= D190), E216 (= E218), D241 (= D243)
3q45A Crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val (see paper)
36% identity, 97% coverage: 1:353/364 of query aligns to 1:351/368 of 3q45A
- active site: F19 (= F19), P50 (≠ A50), T53 (≠ V53), T135 (= T135), K160 (= K160), K162 (= K162), D190 (= D190), N192 (= N192), E216 (= E218), D241 (= D243), E242 (= E244), S243 (= S245), K265 (= K267), G292 (= G294), G293 (≠ C295), F294 (≠ M296), Y317 (≠ V320), D318 (= D321), F319 (≠ L322)
- binding d-alanine: F19 (= F19), K162 (= K162), D318 (= D321), D320 (= D323), T321 (≠ G324)
- binding magnesium ion: D190 (= D190), E216 (= E218), D241 (= D243)
- binding valine: K160 (= K160), K162 (= K162), D190 (= D190), K265 (= K267), G293 (≠ C295), F294 (≠ M296)
3desA Crystal structure of dipeptide epimerase from thermotoga maritima complexed with l-ala-l-phe dipeptide (see paper)
34% identity, 85% coverage: 2:312/364 of query aligns to 1:307/341 of 3desA
- active site: F18 (= F19), T132 (= T135), K157 (= K160), K159 (= K162), D186 (= D190), E214 (= E218), D239 (= D243), E240 (= E244), S241 (= S245), K263 (= K267), G289 (= G294), C290 (= C295), M291 (= M296)
- binding alanine: K159 (= K162), C290 (= C295)
- binding magnesium ion: D186 (= D190), E214 (= E218), D239 (= D243)
- binding phenylalanine: K159 (= K162), D186 (= D190), D239 (= D243), K263 (= K267), C290 (= C295), M291 (= M296)
Sites not aligning to the query:
3derA Crystal structure of dipeptide epimerase from thermotoga maritima complexed with l-ala-l-lys dipeptide (see paper)
34% identity, 85% coverage: 2:312/364 of query aligns to 1:307/341 of 3derA
- active site: F18 (= F19), T132 (= T135), K157 (= K160), K159 (= K162), D186 (= D190), E214 (= E218), D239 (= D243), E240 (= E244), S241 (= S245), K263 (= K267), G289 (= G294), C290 (= C295), M291 (= M296)
- binding alanine: K159 (= K162), C290 (= C295)
- binding lysine: F18 (= F19), K159 (= K162), D186 (= D190), K263 (= K267), C290 (= C295)
- binding magnesium ion: D186 (= D190), E214 (= E218), D239 (= D243)
Sites not aligning to the query:
Query Sequence
>WP_057508212.1 NCBI__GCF_001431535.1:WP_057508212.1
MKITDIELGMLRVPLKTPFKTALRTVDTVEDVVVMIRTDTGHTGYGEAAATAVITGDTHG
SIIEAIRHFIKPRLVGQDVANLNRLCALVQSSMERNSSAKAAVEIALYDLWAQLHDAPLY
QMLGGGDPVITTDITISVDYIDKMVADSLSALDRGFESLKIKVGKDIGLDIERVKAIHAA
VQGRALLRLDANQGWTAKQAVQAMQALEEAGVVLELLEQPVKAADIAGLKYVTDRVNTPV
MADESVFNPSQVIDLIQQRAADIVNIKLMKTGGLSNAIRIADIAAIHGVPCMIGCMIESS
ISVAAAVHLAVAKSDVITKVDLDGPSLGQFDPVSGGVTFNESEISISDAPGLGITEVRGL
EMLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory