Comparing WP_057508378.1 NCBI__GCF_001431535.1:WP_057508378.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
56% identity, 98% coverage: 1:323/329 of query aligns to 7:338/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
29% identity, 48% coverage: 109:265/329 of query aligns to 93:243/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
29% identity, 48% coverage: 109:265/329 of query aligns to 93:243/290 of 8gsrA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
25% identity, 67% coverage: 45:265/329 of query aligns to 28:226/265 of 3r6oA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
25% identity, 61% coverage: 64:265/329 of query aligns to 76:267/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
25% identity, 61% coverage: 64:265/329 of query aligns to 75:266/303 of 8skyB
>WP_057508378.1 NCBI__GCF_001431535.1:WP_057508378.1
MKLGSLKEGGRDGTLIVVSRDLQHGVRATGIAATLQAALEDWARTAPRLQALSESLNTGD
ADGVFDIDMQALASPLPRAYEFLDGSAYLPHVARVRRARGAEVPDSFYTDPLMYQATSAG
FHGPRDAVKVVSEDHGIDLEAEIVVITDDVPMAVSPEQAADHIQLIGLVNDVSLRNLIPG
ELAKGFGFLQSKPRSALSPVFVTPDELGDAWRDSKLHLPLVTHVNGTWFGAPEAGVDMQF
NFGQLVAHAARTRPLGAGTIVGSGTIANEDTSKGASCFAELRTVETLRDGKPSTPFMSFG
DVVRIEMLDANGASIFGAIEQRIEQAAKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory