SitesBLAST
Comparing WP_057508390.1 NCBI__GCF_001431535.1:WP_057508390.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
49% identity, 100% coverage: 1:312/312 of query aligns to 19:330/333 of P13804
- 20:204 (vs. 2:186, 36% identical) Domain I
- G116 (= G97) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ A153) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R205) binding
- S248 (= S230) binding
- R249 (= R231) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 245:248) binding
- T266 (= T248) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 263:268) binding
- N300 (= N282) binding
- DL 318:319 (= DL 300:301) binding
Sites not aligning to the query:
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
49% identity, 100% coverage: 1:312/312 of query aligns to 1:312/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G204), R205 (= R205), S230 (= S230), R231 (= R231), A232 (= A232), Q244 (= Q244), V245 (= V245), G246 (= G246), T248 (= T248), G261 (= G261), I262 (= I262), S263 (= S263), A265 (= A265), Q267 (= Q267), H268 (= H268), N282 (= N282), K283 (= K283), D300 (= D300), L301 (= L301)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
53% identity, 99% coverage: 4:312/312 of query aligns to 2:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G204), R200 (= R205), G201 (= G206), S225 (= S230), R226 (= R231), A227 (= A232), Q239 (= Q244), V240 (= V245), G241 (= G246), T243 (= T248), G256 (= G261), I257 (= I262), S258 (= S263), A260 (= A265), Q262 (= Q267), H263 (= H268), N277 (= N282), K278 (= K283), D295 (= D300), L296 (= L301)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
37% identity, 74% coverage: 76:306/312 of query aligns to 130:382/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (≠ Q112), R200 (= R127), M281 (≠ R205), G282 (= G206), R307 (= R231), A308 (= A232), Q320 (= Q244), V321 (= V245), G322 (= G246), Q323 (= Q247), T324 (= T248), G337 (= G261), I338 (= I262), S339 (= S263), Q343 (= Q267), H344 (= H268), N358 (= N282), K359 (= K283), L377 (= L301)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
34% identity, 100% coverage: 1:312/312 of query aligns to 1:324/331 of 5ol2A
- binding calcium ion: E75 (≠ N69), D188 (≠ T177)
- binding flavin-adenine dinucleotide: T117 (≠ V113), R136 (= R127), I147 (≠ V138), G216 (= G204), R217 (= R205), G218 (= G206), S242 (= S230), R243 (= R231), A244 (= A232), Q256 (= Q244), V257 (= V245), G258 (= G246), T260 (= T248), G273 (= G261), I274 (= I262), S275 (= S263), A277 (= A265), Q279 (= Q267), H280 (= H268), N294 (= N282), K295 (= K283), D312 (= D300), V313 (≠ L301)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
37% identity, 71% coverage: 87:308/312 of query aligns to 100:328/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (≠ Q112), R144 (= R127), I155 (≠ V138), G224 (= G204), R225 (= R205), G226 (= G206), S250 (= S230), R251 (= R231), A252 (= A232), Q264 (= Q244), V265 (= V245), G266 (= G246), Q267 (= Q247), S268 (≠ T248), G281 (= G261), I282 (= I262), S283 (= S263), S285 (≠ A265), Q287 (= Q267), H288 (= H268), N302 (= N282), K303 (= K283), D320 (= D300), A321 (≠ L301)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
36% identity, 99% coverage: 4:312/312 of query aligns to 7:327/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (≠ V113), R140 (= R127), T142 (≠ I129), G219 (= G204), K220 (≠ R205), G221 (= G206), S245 (= S230), R246 (= R231), A247 (= A232), Q259 (= Q244), V260 (= V245), G261 (= G246), Q262 (= Q247), T263 (= T248), G276 (= G261), S278 (= S263), Q282 (= Q267), H283 (= H268), N297 (= N282), I298 (≠ K283), L316 (= L301)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 98% coverage: 4:308/312 of query aligns to 13:327/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (≠ Q112), T126 (≠ V113), R144 (= R127), I155 (≠ V138), R224 (= R205), G225 (= G206), T249 (≠ S230), R250 (= R231), Q263 (= Q244), I264 (≠ V245), G265 (= G246), L266 (≠ Q247), S267 (≠ T248), G280 (= G261), I281 (= I262), S282 (= S263), Q286 (= Q267), N301 (= N282), S302 (≠ K283), D303 (= D284), D319 (= D300), L320 (= L301)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
36% identity, 73% coverage: 86:312/312 of query aligns to 69:291/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G204), R184 (= R205), G185 (= G206), S209 (= S230), R210 (= R231), Q223 (= Q244), I224 (≠ V245), G225 (= G246), T227 (= T248), G240 (= G261), V241 (≠ I262), S242 (= S263), A244 (= A265), Q246 (= Q267), H247 (= H268), N261 (= N282), K262 (= K283), D279 (= D300), Y280 (≠ L301)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
32% identity, 100% coverage: 1:312/312 of query aligns to 1:319/321 of P53571
- M1 (= M1) modified: Initiator methionine, Removed
- R211 (= R205) binding
- SR 236:237 (= SR 230:231) binding
- QVGQS 250:254 (≠ QVGQT 244:248) binding
- 268:275 (vs. 261:268, 88% identical) binding
- N289 (= N282) binding
- DI 307:308 (≠ DL 300:301) binding
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
31% identity, 100% coverage: 2:312/312 of query aligns to 1:318/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G204), R210 (= R205), G211 (= G206), S235 (= S230), A236 (≠ R231), P237 (≠ A232), Q249 (= Q244), V250 (= V245), G251 (= G246), Q252 (= Q247), S253 (≠ T248), G267 (= G261), I268 (= I262), S269 (= S263), S271 (≠ A265), Q273 (= Q267), H274 (= H268), N288 (= N282), T289 (≠ K283), D306 (= D300), I307 (≠ L301)
Query Sequence
>WP_057508390.1 NCBI__GCF_001431535.1:WP_057508390.1
MSTILVIAEHHDGKLNAATAKTVSAATAISGAEVHVLVLAADPTAVAAEAAKINGVSKVL
TVANAANANPIAQVLAPQIAKAAAGYSHVFGPSTTFGKDLMPCVAALLGVAQVSDLMTVE
GSHTFKRPIYAGNAIITVEAPADQTVVATVRSASWPEAAQGGSASVEALSVEATLPTHTR
FVGLAAASSDRPDLQSAKRVVSGGRGVGSEENFKVIYQLADKLGAAVGASRAAVDAGYVP
NELQVGQTGKIIAPELYLAIGISGAIQHLTGIKDAGTIVAINKDPDSPIFEIADIGLVGD
LFTLLPELESAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory