Comparing WP_057508398.1 NCBI__GCF_001431535.1:WP_057508398.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
56% identity, 98% coverage: 5:242/244 of query aligns to 33:287/520 of Q29551
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
57% identity, 93% coverage: 13:240/244 of query aligns to 2:246/468 of 1o9lA
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
57% identity, 94% coverage: 13:241/244 of query aligns to 2:247/466 of 3k6mC
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
57% identity, 93% coverage: 13:240/244 of query aligns to 2:246/462 of 3oxoE
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
51% identity, 90% coverage: 26:244/244 of query aligns to 15:251/471 of 8i3yD
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
51% identity, 93% coverage: 14:239/244 of query aligns to 4:246/467 of 8i40A
Sites not aligning to the query:
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
51% identity, 93% coverage: 14:239/244 of query aligns to 4:246/459 of 8i3yA
Sites not aligning to the query:
9cq2A Ctfab e46d active site mutant hydrolase (see paper)
47% identity, 82% coverage: 25:225/244 of query aligns to 12:212/213 of 9cq2A
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
44% identity, 83% coverage: 24:225/244 of query aligns to 13:214/219 of 1k6dB
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
25% identity, 49% coverage: 110:228/244 of query aligns to 114:251/512 of 2ahvA
Sites not aligning to the query:
>WP_057508398.1 NCBI__GCF_001431535.1:WP_057508398.1
MTTPATTGQRRDKRYASAALALQGVVADGQTLAVGGFGLCGIPEALIAALRDSGVGGLTV
ISNNAGVDGFGLGQLLATRQIRKMISSYVGENKEFERQFLAGELELEFNPQGTLAERLRA
GGAGIPAFFTATGYGTVVAEGKETREFDGRHYVMETALRADVALVKAWKADEAGNLVFRR
TARNFNPACAMAGKVCIAEVEEVVPVGSIDPDHVHLPGIYVHRIVHNPTPEKRIEQRTVR
TENT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory