Comparing WP_057508402.1 NCBI__GCF_001431535.1:WP_057508402.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
37% identity, 87% coverage: 23:262/276 of query aligns to 5:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
37% identity, 87% coverage: 23:262/276 of query aligns to 5:242/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
37% identity, 87% coverage: 23:262/276 of query aligns to 3:240/253 of 6z5uK
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
37% identity, 87% coverage: 22:262/276 of query aligns to 3:241/262 of 7chaI
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
35% identity, 87% coverage: 22:262/276 of query aligns to 3:238/259 of 7ch8I
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 89% coverage: 16:262/276 of query aligns to 78:337/345 of Q9AT00
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
38% identity, 83% coverage: 33:262/276 of query aligns to 15:242/264 of 6xgyA
Sites not aligning to the query:
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
38% identity, 83% coverage: 33:262/276 of query aligns to 15:242/265 of 7ch6C
Sites not aligning to the query:
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
37% identity, 83% coverage: 33:262/276 of query aligns to 15:242/263 of 7cgnB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 87% coverage: 23:261/276 of query aligns to 2:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 87% coverage: 23:261/276 of query aligns to 3:247/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 87% coverage: 23:261/276 of query aligns to 3:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 87% coverage: 23:261/276 of query aligns to 3:247/344 of 3tuiC
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
35% identity, 81% coverage: 18:240/276 of query aligns to 344:578/611 of 8j5qD
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
34% identity, 78% coverage: 21:234/276 of query aligns to 5:202/353 of 1vciA
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
35% identity, 81% coverage: 18:240/276 of query aligns to 344:578/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
35% identity, 81% coverage: 18:240/276 of query aligns to 344:578/608 of 8j5sD
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 82% coverage: 29:254/276 of query aligns to 12:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 82% coverage: 29:254/276 of query aligns to 12:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 82% coverage: 29:254/276 of query aligns to 12:232/353 of 1oxuA
>WP_057508402.1 NCBI__GCF_001431535.1:WP_057508402.1
MVNDERTDDIHDASGEDDAKLAIRVRGLVNRFGSQTVHEGLDLDVRRGEILGVVGGSGTG
KSVLMRSILGLRSPDEGQIEVLGRDARGGDSESRLHIQRNTGVLFQDGALFSSLTVGENV
QVPLKEHHRELPERWHYELALLKVKLAGLPADAINKLPSQLSGGMRKRAGLARALALDPP
LLFLDEPTAGLDPIGAAAFDRLIKTLQEALGLTVFLITHDLDTLYAICDRVAVLADRKVV
ATAPLADIEKLDHPWIQDYFHGPRARAARGEQTESA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory