Comparing WP_057508416.1 NCBI__GCF_001431535.1:WP_057508416.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
34% identity, 56% coverage: 70:181/201 of query aligns to 74:188/190 of 5u2kA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 77% coverage: 33:186/201 of query aligns to 41:195/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
33% identity, 77% coverage: 33:186/201 of query aligns to 40:194/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
33% identity, 77% coverage: 33:186/201 of query aligns to 40:194/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 77% coverage: 33:186/201 of query aligns to 40:194/200 of 1krrA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
35% identity, 53% coverage: 70:176/201 of query aligns to 74:186/186 of 4isxA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
30% identity, 73% coverage: 26:172/201 of query aligns to 146:275/307 of A1ADJ6
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
52% identity, 30% coverage: 122:182/201 of query aligns to 106:167/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
52% identity, 30% coverage: 122:182/201 of query aligns to 109:170/210 of 6pubA
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
57% identity, 27% coverage: 121:174/201 of query aligns to 130:183/188 of 3igjC
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
46% identity, 31% coverage: 118:180/201 of query aligns to 107:169/211 of 4hurA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
46% identity, 31% coverage: 118:180/201 of query aligns to 107:169/212 of 4husA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
46% identity, 31% coverage: 118:180/201 of query aligns to 107:169/207 of 6x3cA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
46% identity, 31% coverage: 118:180/201 of query aligns to 107:169/206 of 6x3jA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
46% identity, 31% coverage: 118:180/201 of query aligns to 107:169/203 of 6x3cE
Sites not aligning to the query:
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
37% identity, 57% coverage: 61:174/201 of query aligns to 93:219/259 of 3fscA
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d- glucose n-acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
37% identity, 57% coverage: 61:174/201 of query aligns to 93:219/259 of 3fs8A
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
31% identity, 64% coverage: 70:197/201 of query aligns to 54:183/208 of 2xatA
Sites not aligning to the query:
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
37% identity, 57% coverage: 61:174/201 of query aligns to 93:219/260 of 3fsbA
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
40% identity, 31% coverage: 116:177/201 of query aligns to 106:167/204 of 1mrlA
Sites not aligning to the query:
>WP_057508416.1 NCBI__GCF_001431535.1:WP_057508416.1
MKKLKVWLLHQRFFYVLMGLKYYVGNNIVARFPNERLRAMYLRRVMKVAVGQDTHVSMRW
FVTGYPVRANVTIGNNCVINREVYLDGRVGVHIGNNVNVSFQTCILSLHHDHNSPDFIAV
GSAVTIQDHVWIGARATILPGVTVGEGAVIAAGAVVARDVPAYDVVGGVPAKKIGERNRD
IRYLTKFSPYFDSDIFDETAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory