SitesBLAST
Comparing WP_057508452.1 NCBI__GCF_001431535.1:WP_057508452.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
51% identity, 84% coverage: 58:431/446 of query aligns to 50:426/430 of 7arcF
- binding flavin mononucleotide: G61 (= G69), R62 (= R70), K72 (= K80), N90 (= N96), D92 (= D98), E93 (= E99), S94 (= S100), Y178 (= Y185), G181 (= G188), E182 (= E189), T217 (≠ N224), N218 (= N225), L401 (≠ F406)
- binding iron/sulfur cluster: S352 (= S357), C353 (= C358), G354 (= G359), Q355 (= Q360), C356 (= C361), C359 (= C364), T397 (= T402), C399 (= C404), L401 (≠ F406)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
51% identity, 82% coverage: 58:421/446 of query aligns to 49:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G69), R61 (= R70), G62 (= G71), K71 (= K80), N89 (= N96), D91 (= D98), Y177 (= Y185), G180 (= G188), E181 (= E189), E182 (= E190), T216 (≠ N224), N217 (= N225)
- binding iron/sulfur cluster: S351 (= S357), C352 (= C358), G353 (= G359), Q354 (= Q360), C355 (= C361), C358 (= C364), T396 (= T402), C398 (= C404), L400 (≠ F406)
8gymv1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
47% identity, 93% coverage: 21:434/446 of query aligns to 12:427/442 of 8gymv1
- binding flavin mononucleotide: G58 (= G69), G60 (= G71), N88 (= N96), D90 (= D98), Y176 (= Y185), E180 (= E189), E181 (= E190), T215 (≠ N224), N216 (= N225), T219 (= T228), A398 (= A405), L399 (≠ F406)
- binding iron/sulfur cluster: I177 (= I186), P195 (= P204), C351 (= C358), G352 (= G359), Q353 (= Q360), C354 (= C361), C357 (= C364), T395 (= T402), C397 (= C404), L399 (≠ F406), G400 (= G407)
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 23:429/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G69), G71 (= G71), K80 (= K80), N98 (= N96), D100 (= D98), G189 (= G188), E191 (= E190), N226 (= N225), A408 (= A405), L409 (≠ F406)
- binding iron/sulfur cluster: P205 (= P204), C361 (= C358), G362 (= G359), Q363 (= Q360), C364 (= C361), C367 (= C364), T405 (= T402), C407 (= C404), L409 (≠ F406)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 21:427/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G69), G69 (= G71), K78 (= K80), N96 (= N96), D98 (= D98), E99 (= E99), G187 (= G188), E188 (= E189), N224 (= N225), A406 (= A405)
- binding iron/sulfur cluster: I185 (= I186), P203 (= P204), C359 (= C358), Q361 (= Q360), C362 (= C361), C365 (= C364), T403 (= T402), I404 (= I403), C405 (= C404), L407 (≠ F406)
- binding : Y143 (≠ H143), N144 (≠ H144), Q150 (≠ E151), D174 (= D175)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
46% identity, 94% coverage: 8:425/446 of query aligns to 1:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G69), K74 (= K80), N91 (= N96), D93 (= D98), Y179 (= Y185), G182 (= G188), E183 (= E189), N218 (= N224), N219 (= N225), L401 (≠ F406)
- binding iron/sulfur cluster: I180 (= I186), P198 (= P204), S351 (= S357), C352 (= C358), G353 (= G359), K354 (≠ Q360), C355 (= C361), C358 (= C364), F398 (≠ I403), C399 (= C404), L401 (≠ F406)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
46% identity, 94% coverage: 8:425/446 of query aligns to 1:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G69), G65 (= G71), N91 (= N96), D93 (= D98), G182 (= G188), E183 (= E189), E184 (= E190), N218 (= N224), N219 (= N225), T222 (= T228), P400 (≠ A405)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G71), G66 (= G72), F69 (= F75), K74 (= K80), F77 (= F83), E96 (= E101), Y179 (= Y185), E184 (= E190), K201 (= K207), F204 (= F210), T324 (≠ S330)
- binding iron/sulfur cluster: S351 (= S357), C352 (= C358), K354 (≠ Q360), C355 (= C361), C358 (= C364), F398 (≠ I403), C399 (= C404), L401 (≠ F406), A402 (≠ G407)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
46% identity, 94% coverage: 8:425/446 of query aligns to 2:421/438 of Q56222
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 41:447/464 of P49821
- C379 (= C358) binding
- C382 (= C361) binding
- C385 (= C364) binding
- C425 (= C404) binding
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
46% identity, 91% coverage: 21:426/446 of query aligns to 41:447/464 of Q91YT0
- C379 (= C358) binding
- C382 (= C361) binding
- C385 (= C364) binding
- C425 (= C404) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
5lnk1 Entire ovine respiratory complex i (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 15:421/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P102), G97 (= G103)
- binding flavin mononucleotide: G61 (= G69), R62 (= R70), K72 (= K80), N90 (= N96), D92 (= D98), E93 (= E99), G94 (≠ S100), Y178 (= Y185), G181 (= G188), E182 (= E189), V216 (≠ I223), A217 (≠ N224), N218 (= N225), T221 (= T228), L401 (≠ F406)
- binding iron/sulfur cluster: P197 (= P204), S352 (= S357), C353 (= C358), Q355 (= Q360), C356 (= C361), C359 (= C364), T397 (= T402), I398 (= I403), C399 (= C404)
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 41:447/464 of P25708
- C379 (= C358) binding
- C382 (= C361) binding
- C385 (= C364) binding
- C425 (= C404) binding
6zk91 Peripheral domain of open complex i during turnover (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 13:419/430 of 6zk91
- binding flavin mononucleotide: G59 (= G69), G61 (= G71), K70 (= K80), N88 (= N96), D90 (= D98), E91 (= E99), G179 (= G188), E180 (= E189), A215 (≠ N224), N216 (= N225), A398 (= A405), L399 (≠ F406)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G71), G62 (= G72), A63 (= A73), F65 (= F75), K70 (= K80), E93 (= E101), Y176 (= Y185), E181 (= E190), F201 (= F210), T323 (≠ S330)
- binding iron/sulfur cluster: I177 (= I186), P195 (= P204), C351 (= C358), G352 (= G359), Q353 (= Q360), C354 (= C361), C357 (= C364), T395 (= T402), C397 (= C404), L399 (≠ F406)
7v2cA Active state complex i from q10 dataset (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 16:422/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G69), K73 (= K80), N91 (= N96), Y179 (= Y185), G182 (= G188), E183 (= E189), N219 (= N225), A401 (= A405), L402 (≠ F406)
- binding iron/sulfur cluster: P198 (= P204), C354 (= C358), G355 (= G359), Q356 (= Q360), C357 (= C361), C360 (= C364), T398 (= T402), C400 (= C404), L402 (≠ F406)
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
46% identity, 91% coverage: 21:426/446 of query aligns to 10:416/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G71), K67 (= K80), N85 (= N96), D87 (= D98), E88 (= E99), G89 (≠ S100), C175 (= C187), G176 (= G188), A212 (≠ N224), N213 (= N225)
- binding iron/sulfur cluster: S347 (= S357), C348 (= C358), G349 (= G359), C351 (= C361), C354 (= C364), C394 (= C404), L396 (≠ F406)
- binding : R121 (≠ T132), Y132 (≠ H143), Q139 (≠ E151), R143 (≠ A155), Y146 (= Y158), E147 (≠ A159), F165 (≠ Y177), R168 (≠ L180)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
44% identity, 93% coverage: 21:436/446 of query aligns to 11:430/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G69), G59 (= G71), K68 (= K80), N89 (= N96), D91 (= D98), E92 (= E99), G180 (= G188), E181 (= E189), E182 (= E190), T216 (≠ N224), N217 (= N225)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G71), G60 (= G72), F63 (= F75), K68 (= K80), E94 (= E101), Y177 (= Y185), E182 (= E190), F202 (= F210), T324 (≠ S330)
- binding iron/sulfur cluster: P196 (= P204), S351 (= S357), C352 (= C358), G353 (= G359), Q354 (= Q360), C355 (= C361), C358 (= C364), T396 (= T402), C398 (= C404), L400 (≠ F406)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
44% identity, 93% coverage: 21:436/446 of query aligns to 12:431/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G71), K69 (= K80), N90 (= N96), D92 (= D98), E93 (= E99), G94 (≠ S100), Y178 (= Y185), G181 (= G188), E182 (= E189), N218 (= N225)
- binding iron/sulfur cluster: P197 (= P204), S352 (= S357), C353 (= C358), Q355 (= Q360), C356 (= C361), C359 (= C364), T397 (= T402), C399 (= C404)
8j9iV1 ndufv1 (see paper)
45% identity, 91% coverage: 21:425/446 of query aligns to 23:430/504 of 8j9iV1
- binding flavin mononucleotide: G69 (= G69), G71 (= G71), K80 (= K80), N100 (= N96), D102 (= D98), E103 (= E99), G191 (= G188), E192 (= E189), V226 (≠ I223), N228 (= N225), T231 (= T228), A410 (= A405), L411 (≠ F406)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G71 (= G71), G72 (= G72), F75 (= F75), K80 (= K80), F83 (= F83), E105 (= E101), Y188 (= Y185), E193 (= E190), F213 (= F210), T335 (≠ S330), A410 (= A405)
- binding iron/sulfur cluster: P207 (= P204), S362 (= S357), C363 (= C358), N364 (≠ G359), Q365 (= Q360), C366 (= C361), C369 (= C364), C409 (= C404), L411 (≠ F406)
8iufV1 ndufv2 (see paper)
45% identity, 91% coverage: 21:425/446 of query aligns to 23:430/504 of 8iufV1
- binding flavin mononucleotide: G69 (= G69), G71 (= G71), K80 (= K80), N100 (= N96), D102 (= D98), Y188 (= Y185), G191 (= G188), E192 (= E189), N228 (= N225), L411 (≠ F406)
- binding iron/sulfur cluster: S362 (= S357), C363 (= C358), N364 (≠ G359), Q365 (= Q360), C366 (= C361), C369 (= C364), C409 (= C404), L411 (≠ F406)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
44% identity, 91% coverage: 21:426/446 of query aligns to 13:422/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G69), G61 (= G71), K70 (= K80), N91 (= N96), D93 (= D98), G182 (= G188), E183 (= E189), E184 (= E190), A218 (≠ N224), N219 (= N225), A401 (= A405), L402 (≠ F406)
- binding iron/sulfur cluster: P198 (= P204), C354 (= C358), G355 (= G359), Q356 (= Q360), C357 (= C361), C360 (= C364), T398 (= T402), C400 (= C404), L402 (≠ F406)
Query Sequence
>WP_057508452.1 NCBI__GCF_001431535.1:WP_057508452.1
MAHHHAPSGPVGPAPLPHQVVYTTLHYDTPWSYESYLKTGGYAALRKILEEKISPEQVIE
MVKQSNLRGRGGAGFPTGLKWSFMPKGTMQKYILCNSDESEPGTCKDRDILRYNPHSVVE
GMAIACYATGSTVGYNYLRGEFHHEPFENFEQALADAYANGWLGKDILGSGVDIDIYGAL
GAGAYICGEETALMESLEGKKGQPRYKPPFPANFGLYGKPSTINNTETYASVPAIIRNGP
EWFQGLSLTKNGGPKIFSVSGCVQQGGNFEVPLGTTFDDLLEMAGGLKPGRTLKGAVPGG
VSMPVLKAEELKGLQMDYDTLRALGTGLGSGAIVVLDDSVCCVKFACRISQFFHKESCGQ
CTPCREGTGWMHRVLERIVAGKATMEDLHQLKAVAGQIEGHTICAFGEAAAWPIQGFLRQ
FWDEFEYYIVNGHSMVDGKKVEAAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory