Comparing WP_057508462.1 NCBI__GCF_001431535.1:WP_057508462.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
40% identity, 99% coverage: 1:257/259 of query aligns to 1:259/261 of 2xuaH
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 91% coverage: 10:245/259 of query aligns to 10:239/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 91% coverage: 10:245/259 of query aligns to 10:242/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 91% coverage: 10:245/259 of query aligns to 10:236/262 of 6eb3C
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 85% coverage: 33:253/259 of query aligns to 37:263/272 of 4uheA
Sites not aligning to the query:
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 85% coverage: 33:253/259 of query aligns to 37:263/274 of 4uhdA
Sites not aligning to the query:
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 85% coverage: 33:253/259 of query aligns to 37:263/278 of 4uhfA
Sites not aligning to the query:
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
27% identity, 79% coverage: 26:230/259 of query aligns to 24:240/271 of 3heaA
Sites not aligning to the query:
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
28% identity, 76% coverage: 33:230/259 of query aligns to 31:240/276 of 8pi1B
Sites not aligning to the query:
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
27% identity, 79% coverage: 26:230/259 of query aligns to 24:240/271 of 3hi4A
Sites not aligning to the query:
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
28% identity, 76% coverage: 33:230/259 of query aligns to 32:241/272 of P22862
Sites not aligning to the query:
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
28% identity, 76% coverage: 33:230/259 of query aligns to 31:240/271 of 3ia2A
Sites not aligning to the query:
3b12A Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. Fa1 in complex with fluoroacetate (see paper)
26% identity, 85% coverage: 21:240/259 of query aligns to 25:272/294 of 3b12A
Q1JU72 Fluoroacetate dehalogenase; EC 3.8.1.3 from Burkholderia sp. (see paper)
26% identity, 85% coverage: 21:240/259 of query aligns to 25:272/304 of Q1JU72
P25026 Non-heme chloroperoxidase; Chloride peroxidase; Chloroperoxidase P; CPO-P; EC 1.11.1.- from Burkholderia pyrrocinia (Pseudomonas pyrrocinia) (see paper)
26% identity, 94% coverage: 17:259/259 of query aligns to 18:278/278 of P25026
1hl7A Gamma lactamase from an aureobacterium species in complex with 3a,4,7, 7a-tetrahydro-benzo [1,3] dioxol-2-one (see paper)
28% identity, 87% coverage: 33:257/259 of query aligns to 35:277/279 of 1hl7A
Sites not aligning to the query:
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
23% identity, 87% coverage: 35:259/259 of query aligns to 35:268/269 of 5h3hB
Sites not aligning to the query:
4ccwA Crystal structure of naproxen esterase (carboxylesterase np) from bacillus subtilis (see paper)
32% identity, 42% coverage: 14:121/259 of query aligns to 40:148/285 of 4ccwA
Sites not aligning to the query:
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
25% identity, 81% coverage: 13:223/259 of query aligns to 54:269/310 of 6i8wB
Sites not aligning to the query:
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
25% identity, 75% coverage: 24:216/259 of query aligns to 21:223/269 of O07015
Sites not aligning to the query:
>WP_057508462.1 NCBI__GCF_001431535.1:WP_057508462.1
MAFLELPRHRLRYVVEGPADAPWLTFCNSLGTDLHMWEPQARAFSGRFRVLRYDRRGHGL
SSTPPGLYTVDDLGADVLALWNHLGIERSHFCGLSIGGLTGQWLGVHAGERLLSLTVAAT
AAKIGSLESWRARIDQVRAAGLQPLLEGTRERWFSTAFAQTHAQQVEDILQRFLTTSAEG
YAGCCNAVGHADFRDRLADIRVPTLAIAGDQDPVCPPADLQAIATGVAQGRYASVPGRHI
CNLESVDAFNAALAAHLHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory