Comparing WP_057508489.1 NCBI__GCF_001431535.1:WP_057508489.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
48% identity, 98% coverage: 11:626/629 of query aligns to 4:625/628 of 3nzqA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
46% identity, 99% coverage: 6:625/629 of query aligns to 1:629/629 of 3n2oB
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
46% identity, 99% coverage: 6:625/629 of query aligns to 2:630/630 of 3n2oA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 91% coverage: 4:577/629 of query aligns to 34:608/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
32% identity, 90% coverage: 44:608/629 of query aligns to 30:562/591 of 3nzpB
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
26% identity, 40% coverage: 97:349/629 of query aligns to 57:289/418 of 4xg1B
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
25% identity, 31% coverage: 167:359/629 of query aligns to 107:285/405 of B4XMC6
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
25% identity, 29% coverage: 167:349/629 of query aligns to 105:273/394 of 3c5qA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
25% identity, 44% coverage: 80:355/629 of query aligns to 51:316/438 of Q58497
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
25% identity, 44% coverage: 80:355/629 of query aligns to 47:312/434 of 1tufA
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
25% identity, 44% coverage: 80:355/629 of query aligns to 47:312/434 of 1twiA
Sites not aligning to the query:
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
25% identity, 40% coverage: 97:349/629 of query aligns to 52:262/393 of 4xg1A
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
24% identity, 41% coverage: 117:374/629 of query aligns to 87:330/442 of 5x7nA
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
24% identity, 41% coverage: 117:374/629 of query aligns to 87:330/443 of 5x7mA
Sites not aligning to the query:
>WP_057508489.1 NCBI__GCF_001431535.1:WP_057508489.1
MTDWSLDQARKTYSIPHWADGYFDVDQAGHMVVRPTGADGPVVSLPDVVDAARANGAKLP
LLVRFPDILGQRLGKLQAAFAQAQADWEYPGGYTAVYPIKVNQHRGVAGTLASHHGEGFG
LEAGSKPELMAVLALSRPGGLIVCNGYKDREYIRLALIGRKLGLQTYIVIEKPSELKLVL
EESKALDVKPGLGVRMRLASLGAGKWQNSGGDKAKFGLSPRQLLDLWKSLRDTEYADCLS
LLHFHMGSQISNVRDIANGMREATRYYVEMSQLGAKITHVDVGGGLGVDYEGTRSRSFCS
INYGLNSYASSIVQPLADACKEHGLKPPRIVTECGRAMTAHHAVLIANVSEVEQAMEGRV
PDQHDDEPASIRHLREIHSELGQRPAIELFQEAQHFHAEGLSSYALGQIDLPQRARIDDL
FYAIAHAVRARLSFDEKSHRPVLDELNERLVDKYFVNFSVFESIPDVWAIDQVFPIVPIE
RLDEQPDRRGIIADMTCDSDGMVETYVGNESLDSSLPLHALRSGESYRIGFFMVGAYQEI
LGDIHNLFGDTDAVEVRAGAGGYAITQQRRGDTTDVMLDYVGYSLAELRATYAERVAAAG
LTADRAQELSDALEAGLTGYTYLSDEPLM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory