Comparing WP_057508494.1 NCBI__GCF_001431535.1:WP_057508494.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0R5R7 Putative aminotransferase MSMEG_6286/MSMEI_6121 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
46% identity, 91% coverage: 15:412/436 of query aligns to 9:415/428 of A0R5R7
6u7aD Rv3722c in complex with kynurenine (see paper)
47% identity, 91% coverage: 23:419/436 of query aligns to 23:419/429 of 6u7aD
5c6uA Rv3722c aminotransferase from mycobacterium tuberculosis
47% identity, 91% coverage: 23:419/436 of query aligns to 23:419/427 of 5c6uA
O69689 Aspartate aminotransferase; AspAT; EC 2.6.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
47% identity, 91% coverage: 23:419/436 of query aligns to 24:420/435 of O69689
6u78B Rv3722c in complex with glutamic acid (see paper)
47% identity, 91% coverage: 23:419/436 of query aligns to 23:419/421 of 6u78B
6u7aA Rv3722c in complex with kynurenine (see paper)
47% identity, 91% coverage: 23:420/436 of query aligns to 23:420/423 of 6u7aA
3pplA Crystal structure of an aspartate transaminase (ncgl0237, cgl0240) from corynebacterium glutamicum atcc 13032 kitasato at 1.25 a resolution
42% identity, 93% coverage: 15:419/436 of query aligns to 18:421/424 of 3pplA
5iwqB Crystal structure of aspartate aminotransferase (aspat) from corynebacterium glutamicum atcc 13032 (see paper)
42% identity, 93% coverage: 15:419/436 of query aligns to 16:419/424 of 5iwqB
Q8NTR2 Aspartate aminotransferase; AspAT; EC 2.6.1.1 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
42% identity, 93% coverage: 15:419/436 of query aligns to 25:428/432 of Q8NTR2
5hxxA Crystal structure of aspat from corynebacterium glutamicum
42% identity, 93% coverage: 15:419/436 of query aligns to 16:419/424 of 5hxxA
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
24% identity, 74% coverage: 62:382/436 of query aligns to 63:361/397 of 2zyjA
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
24% identity, 74% coverage: 62:382/436 of query aligns to 63:361/397 of Q72LL6
Sites not aligning to the query:
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
24% identity, 74% coverage: 62:382/436 of query aligns to 59:357/392 of 3cbfA
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
24% identity, 74% coverage: 62:382/436 of query aligns to 59:357/392 of 2egyA
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
24% identity, 74% coverage: 62:382/436 of query aligns to 55:353/389 of 2z1yA
Sites not aligning to the query:
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
22% identity, 51% coverage: 153:374/436 of query aligns to 145:361/404 of 3wx9A
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
22% identity, 51% coverage: 153:374/436 of query aligns to 145:361/404 of 3av7A
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
22% identity, 51% coverage: 153:374/436 of query aligns to 145:361/404 of 3aowC
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
22% identity, 51% coverage: 153:374/436 of query aligns to 145:361/404 of 3aovA
Sites not aligning to the query:
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
21% identity, 47% coverage: 152:356/436 of query aligns to 152:354/420 of 1vp4A
Sites not aligning to the query:
>WP_057508494.1 NCBI__GCF_001431535.1:WP_057508494.1
MEVAGLSLDGCHRLDELRAWHDACRKAPVAFDMTRGLPSDEQIALSHAMLSLPGPAPFDS
GDGQDWLNYGGQQGIPQLRALLAPLLLGVPATQAAVGGNSSLALMHAAVGLAWRIGLPGH
APWSDAHEVRFLCPVPGYDRHFAICSDHGIALVPVPMGHDGPDMERVEKHVAQDPRIRGM
WCVPRHSNPCGATYSAEVLRRLATMHAAAPDFTLFCDNAYAIHDFAPQALARPGLYDACA
TAGNPDRVLLFGSTSKMTIPGAGVALLGGSARIMDWWLAAQRACTIGPDKVNQVRHLRFF
GNAAGVARHMQQHGHLLQQRFAQVQRVFAQRLRTPCDVHWSRPAGGYFITLWLPTGCARR
VVSLASQAGVRLTPAGTTHCGGTDPEDRCLRIAPSRLPVADAARAAEIIAGCVLLACADA
ASVACDTTATAPDAHP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory