Comparing WP_057508587.1 NCBI__GCF_001431535.1:WP_057508587.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8usuA Crystal structure of l-galactose 1-dehydrogenase of myrciaria dubia in complex with NAD (see paper)
31% identity, 79% coverage: 52:353/382 of query aligns to 6:279/316 of 8usuA
7eziA Rice l-galactose dehydrogenase (apo form)
31% identity, 79% coverage: 54:353/382 of query aligns to 17:285/323 of 7eziA
7ezlA Rice l-galactose dehydrogenase (holo form)
31% identity, 76% coverage: 63:353/382 of query aligns to 18:280/318 of 7ezlA
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
29% identity, 76% coverage: 63:353/382 of query aligns to 17:279/315 of 7svqA
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
26% identity, 81% coverage: 52:360/382 of query aligns to 5:309/326 of P77256
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
25% identity, 78% coverage: 63:360/382 of query aligns to 16:297/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
25% identity, 78% coverage: 63:360/382 of query aligns to 15:296/311 of 1pz0A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
27% identity, 77% coverage: 61:356/382 of query aligns to 15:271/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 77% coverage: 61:356/382 of query aligns to 15:271/298 of 1ynpB
Sites not aligning to the query:
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
25% identity, 77% coverage: 61:356/382 of query aligns to 15:256/283 of 1ynpA
Sites not aligning to the query:
1lqaA Tas protein from escherichia coli in complex with NADPH (see paper)
26% identity, 82% coverage: 63:374/382 of query aligns to 16:340/346 of 1lqaA
P0A9T4 Protein tas from Escherichia coli (strain K12) (see paper)
26% identity, 82% coverage: 63:374/382 of query aligns to 16:340/346 of P0A9T4
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
31% identity, 48% coverage: 63:244/382 of query aligns to 26:181/259 of 4exaF
Sites not aligning to the query:
8hw0A The structure of akr6d1
28% identity, 72% coverage: 82:357/382 of query aligns to 33:302/329 of 8hw0A
Sites not aligning to the query:
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
26% identity, 73% coverage: 80:356/382 of query aligns to 41:304/335 of 4aubB
Sites not aligning to the query:
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
26% identity, 62% coverage: 61:296/382 of query aligns to 14:221/333 of 1pz1A
Sites not aligning to the query:
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
26% identity, 62% coverage: 61:296/382 of query aligns to 14:221/331 of P80874
Sites not aligning to the query:
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
28% identity, 75% coverage: 73:357/382 of query aligns to 35:297/315 of 5t79A
Sites not aligning to the query:
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
28% identity, 75% coverage: 73:357/382 of query aligns to 34:292/312 of 3erpA
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
26% identity, 73% coverage: 80:356/382 of query aligns to 42:291/315 of 3n6qD
Sites not aligning to the query:
>WP_057508587.1 NCBI__GCF_001431535.1:WP_057508587.1
MNSRRQFLSLAAASAAMMAASPLFAQSPAPGSVLPTRGTPRTGKKPATQTPPKGSRYRPP
TRLGLGGAPLGGSLGPTTREAADATMAAAWAAGVRLFDTSPWYGLGLSERRMGHELHTHP
ADAYTLSTKVGRLLTGTAGPLQKTNWHDPAPFRYRYDYSADGARRSVEDSLNRLGVSQLD
IVYIHDLSPENEKDLGMPWEQRFAEALRGAMPELTRMREEGLIKGWGFGVNRPQPALRAV
AEADPDIMLLACQYSLLDHETALHDTFPKLAEKGVSVMVGSPLLAGYLTGRERYLYGSPI
PEWAPAKRAKIAEVCQRHGIDIRTAALQFADAPDVVSSIIPGARTPEQVRANVESMAIAI
PADFWAELKQLKLIAADAPVPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory