Comparing WP_057508605.1 NCBI__GCF_001431535.1:WP_057508605.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
31% identity, 90% coverage: 30:365/373 of query aligns to 1:343/354 of 3ly1D
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
30% identity, 83% coverage: 47:356/373 of query aligns to 35:345/360 of 8bj3A
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
28% identity, 87% coverage: 39:363/373 of query aligns to 17:342/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
28% identity, 87% coverage: 39:363/373 of query aligns to 17:342/353 of 4r2nA
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
28% identity, 86% coverage: 47:367/373 of query aligns to 30:349/353 of 7szpA
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
31% identity, 86% coverage: 47:366/373 of query aligns to 28:355/364 of 3cq6A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
31% identity, 86% coverage: 47:366/373 of query aligns to 30:357/366 of 3cq5B
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
26% identity, 87% coverage: 45:367/373 of query aligns to 14:335/335 of 1geyA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
27% identity, 76% coverage: 86:367/373 of query aligns to 63:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
27% identity, 76% coverage: 86:367/373 of query aligns to 63:349/354 of 1fg3A
Sites not aligning to the query:
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
26% identity, 83% coverage: 52:361/373 of query aligns to 39:355/369 of 4wbtA
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
28% identity, 85% coverage: 48:363/373 of query aligns to 20:343/356 of 1lc8A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
28% identity, 85% coverage: 48:363/373 of query aligns to 19:342/355 of 1lkcA
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
28% identity, 85% coverage: 48:363/373 of query aligns to 23:346/358 of 1lc7A
Sites not aligning to the query:
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 85% coverage: 48:363/373 of query aligns to 26:349/364 of P97084
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
28% identity, 87% coverage: 46:371/373 of query aligns to 29:362/369 of 4r8dA
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
24% identity, 51% coverage: 82:270/373 of query aligns to 75:276/402 of P14909
Sites not aligning to the query:
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
36% identity, 22% coverage: 171:251/373 of query aligns to 135:211/328 of 1uu0A
Sites not aligning to the query:
Q9ZQI7 Aminotransferase ALD1, chloroplastic; AGD2-like defense response protein 1; EC 2.6.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 46% coverage: 79:249/373 of query aligns to 116:297/456 of Q9ZQI7
Sites not aligning to the query:
4fl0B Crystal structure of ald1 from arabidopsis thaliana (see paper)
26% identity, 46% coverage: 79:249/373 of query aligns to 83:264/409 of 4fl0B
>WP_057508605.1 NCBI__GCF_001431535.1:WP_057508605.1
MPLPTSRRRFLQLAGTGLALAGNPLAAVAGTPRPLAASPTRSDPAPILLNFNECPYGPSP
AAQQAARDSVAASGRYQFALASELRDAFAHGEQLDPKQVRLFPGSSEPLNRAALLWTGPE
AALVTADPTFETLGEMAAARGALVHRIALRADGAHDVRAMVDAARQQPTGLIYICNPNNP
TGSITPRADLDWLLANKPAATRVLLDEAYLQYSEQASLAGEAGKRDDLIVLRTFSKLYGM
AGLRLGVAIAAPARLAELATLGDNPLPVPALAAGLASLRDPLLVPQRRLQNAQVRQATIA
WLGKRGFACIPSEANCFMVDVGRNGAEWVAAMKAQGVVIGRSWPIWPQRVRVTVGSEAEM
ERFRDAFAIVAGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory