Comparing WP_057508709.1 NCBI__GCF_001431535.1:WP_057508709.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ld9A Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with cystathionine
82% identity, 95% coverage: 8:400/412 of query aligns to 1:387/387 of 6ld9A
6lgoA Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with homolanthionine
82% identity, 95% coverage: 8:400/412 of query aligns to 1:387/387 of 6lgoA
6ld8A Crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. Oryzae in complex with aminoacrylate and cysteine
82% identity, 95% coverage: 8:400/412 of query aligns to 1:387/388 of 6ld8A
P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see paper)
59% identity, 92% coverage: 12:389/412 of query aligns to 4:376/386 of P00935
1cs1D Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
59% identity, 92% coverage: 12:389/412 of query aligns to 2:374/384 of 1cs1D
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
47% identity, 93% coverage: 12:393/412 of query aligns to 3:380/384 of 4iyoD
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
47% identity, 93% coverage: 12:393/412 of query aligns to 3:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
47% identity, 93% coverage: 12:393/412 of query aligns to 3:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
47% identity, 93% coverage: 12:393/412 of query aligns to 3:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
47% identity, 93% coverage: 12:393/412 of query aligns to 3:380/381 of 4ixzA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
45% identity, 92% coverage: 15:395/412 of query aligns to 5:372/373 of 4l0oH
4ixsB Native structure of xometc at ph 5.2 (see paper)
47% identity, 93% coverage: 12:393/412 of query aligns to 2:371/372 of 4ixsB
3qhxA Crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes (see paper)
48% identity, 92% coverage: 15:393/412 of query aligns to 5:376/377 of 3qhxA
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
45% identity, 93% coverage: 9:393/412 of query aligns to 3:371/377 of 7ba4A
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
42% identity, 89% coverage: 29:393/412 of query aligns to 19:376/377 of 7d7oB
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
46% identity, 92% coverage: 15:394/412 of query aligns to 7:382/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
46% identity, 92% coverage: 15:394/412 of query aligns to 7:382/382 of 6k1lA
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
43% identity, 93% coverage: 14:395/412 of query aligns to 9:383/385 of 5x5hA
6ldoA Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with l-serine (see paper)
42% identity, 91% coverage: 15:389/412 of query aligns to 5:371/381 of 6ldoA
6le4A Crystal structure of cystathionine gamma-lyase from lactobacillus plantarum complexed with cystathionine (see paper)
42% identity, 91% coverage: 15:389/412 of query aligns to 5:371/380 of 6le4A
>WP_057508709.1 NCBI__GCF_001431535.1:WP_057508709.1
MSHDNHGTPSCSRTTAAVRAGIDRDSAYGAVTPPIVLSSNFSFDGFGNKRQYDYTRSGNP
TRDLLGEALAELEGGAGGVVTATGMGAISLVLQALLGPEDTLVVPHDAYGGSWRLFNALA
GKGQFKLVTADLTDPRSLAQALAGSPKLVLVETPSNPLLRITDLRFVIDAAHKAGALVVV
DNTFLSPALQQPLAFGADLVLHSTTKYINGHSDVVGGAVVARDPELAQQLTWWANALGLT
GSPFDAFLTLRGLRTLDARLRVHQENTAAIVPLLAAHRAVSAVYYPGLADHPGHAIAARQ
QSGFGAMLSFELVTCDGDDPHAAVRAFVDGLQYFTLAESLGGVESLVAHPATMTHAAMTV
QARQAAGISEGLLRLSVGIESERDLLADLAAALDRAAAVVDAQARQKQVVDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory