SitesBLAST
Comparing WP_057508710.1 NCBI__GCF_001431535.1:WP_057508710.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
45% identity, 73% coverage: 92:354/362 of query aligns to 644:909/916 of O81852
Sites not aligning to the query:
- 441 I→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 443 Q→A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- 522 I→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- 524 Q→A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 94% coverage: 15:356/362 of query aligns to 7:358/359 of P31116
- 11:18 (vs. 19:26, 50% identical) binding
- T93 (= T97) binding
- K117 (= K121) binding
- E208 (= E209) binding ; mutation to D: Increases KM for aspartate-semialdehyde 48-fold and reduces kcat by 50%.; mutation E->L,Q: Loss of activity.
- D219 (= D220) mutation to L: Reduces kcat 150-fold.
- K223 (= K224) mutation to V: Loss of activity.
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
34% identity, 94% coverage: 15:356/362 of query aligns to 6:357/358 of 1tveA
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
34% identity, 94% coverage: 15:356/362 of query aligns to 6:357/358 of 1q7gA
- active site: D218 (= D220), K222 (= K224)
- binding nicotinamide-adenine-dinucleotide-5-hydroxy-4-oxonorvaline: G13 (= G22), V14 (≠ T23), V15 (= V24), E39 (vs. gap), N91 (≠ A96), T92 (= T97), S93 (≠ A98), I97 (≠ V102), P114 (≠ A119), K116 (= K121), A143 (= A149), S173 (= S179), K222 (= K224), A338 (= A337), T343 (= T342)
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
34% identity, 94% coverage: 15:356/362 of query aligns to 6:357/358 of 1ebuD
- active site: D218 (= D220), K222 (= K224)
- binding 3-aminomethyl-pyridinium-adenine-dinucleotide: G11 (= G20), A12 (≠ T21), G13 (= G22), V14 (≠ T23), V15 (= V24), E39 (vs. gap), A40 (vs. gap), N91 (≠ A96), S93 (≠ A98), K116 (= K121), T343 (= T342)
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
34% identity, 94% coverage: 15:356/362 of query aligns to 6:357/358 of 1ebfA
- active site: D218 (= D220), K222 (= K224)
- binding nicotinamide-adenine-dinucleotide: I10 (≠ L19), A12 (≠ T21), G13 (= G22), V14 (≠ T23), V15 (= V24), E39 (vs. gap), A40 (vs. gap), T92 (= T97), S93 (≠ A98), P114 (≠ A119)
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 72% coverage: 92:353/362 of query aligns to 94:364/376 of O94671
- S201 (≠ P194) modified: Phosphoserine
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
23% identity, 94% coverage: 15:355/362 of query aligns to 2:299/302 of 5x9dA
- active site: D196 (= D220), K200 (= K224)
- binding (2R)-3-[[(4S)-3-aminocarbonyl-1-[(2R,3R,4S,5R)-5-[[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxymethyl]-3,4-bis(oxidanyl)oxolan-2-yl]-4H-pyridin-4-yl]sulfanyl]-2-azanyl-propanoic acid: F6 (≠ L19), G7 (= G20), Y8 (≠ T21), G9 (= G22), N10 (≠ T23), V11 (= V24), T37 (≠ N50), R38 (≠ S51), V72 (≠ A96), S73 (≠ T97), S74 (≠ A98), P82 (vs. gap), T100 (≠ A119), N101 (= N120), K102 (= K121), G127 (≠ A149), S131 (≠ A153), N155 (≠ S179), G156 (= G180), T157 (≠ S181), Y183 (≠ F207), A184 (≠ T208), E185 (= E209), D191 (= D215), D196 (= D220), K200 (= K224), A281 (= A337), G282 (= G338), A286 (≠ T342)
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
23% identity, 94% coverage: 15:355/362 of query aligns to 2:297/300 of 7f4cA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F6 (≠ L19), G7 (= G20), Y8 (≠ T21), G9 (= G22), N10 (≠ T23), V11 (= V24), T37 (≠ N50), R38 (≠ S51), R39 (= R52), V72 (≠ A96), S73 (≠ T97), S74 (≠ A98), T100 (≠ A119), K102 (= K121), G127 (≠ A149), S131 (≠ A153), E185 (= E209), G280 (= G338), A284 (≠ T342)
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
32% identity, 83% coverage: 15:314/362 of query aligns to 5:270/332 of 6a0tB
- active site: D191 (= D220), K195 (= K224)
- binding l-homoserine: N150 (≠ S179), G151 (= G180), T152 (≠ S181), Y178 (≠ F207), E180 (= E209), D186 (= D215), K195 (= K224)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G20), G11 (≠ T21), G12 (= G22), T13 (= T23), V14 (= V24), L42 (= L55), V43 (≠ A56), R44 (≠ C57), D45 (= D58), K48 (≠ Q63), R50 (= R69), A73 (= A96), M74 (≠ T97), G75 (≠ A98), A97 (= A119), N98 (= N120), G177 (= G206), E180 (= E209)
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
32% identity, 83% coverage: 15:314/362 of query aligns to 5:270/331 of 6a0sA
- active site: D191 (= D220), K195 (= K224)
- binding l-homoserine: K99 (= K121), N150 (≠ S179), G151 (= G180), T152 (≠ S181), Y178 (≠ F207), E180 (= E209), D186 (= D215), K195 (= K224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (≠ T21), G12 (= G22), T13 (= T23), V14 (= V24), L42 (= L55), V43 (≠ A56), R44 (≠ C57), D45 (= D58), K48 (≠ Q63), R50 (= R69), A73 (= A96), M74 (≠ T97), A97 (= A119), K99 (= K121), G177 (= G206), E180 (= E209)
Sites not aligning to the query:
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
32% identity, 83% coverage: 15:314/362 of query aligns to 5:270/331 of 2ejwA
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
23% identity, 73% coverage: 91:356/362 of query aligns to 86:314/319 of 4xb2A
- active site: D211 (= D220), K215 (= K224)
- binding l-homoserine: A171 (≠ G180), S172 (= S181), D206 (= D215), K215 (= K224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V91 (≠ A96), S92 (≠ T97), S93 (≠ A98), S114 (≠ A119), N115 (= N120), K116 (= K121), S141 (≠ A149), G295 (≠ A337), T300 (= T342)
Sites not aligning to the query:
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
23% identity, 73% coverage: 91:356/362 of query aligns to 86:314/319 of 4xb1A
Sites not aligning to the query:
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
28% identity, 73% coverage: 91:355/362 of query aligns to 73:318/435 of Q5F8J4
Sites not aligning to the query:
- 45 L→R: Shows a marked increase in the catalytic efficiency with NADP(+).
- 45:46 LS→RD: Does not impair the catalytic activity with NAD(+). Slightly increases the activity, but slightly decreases the affinity for NADP(+).; LS→RR: Causes a shift in coenzyme preference from NAD(+) to NADP(+) by a factor of 974. Shows a slight decrease in the catalytic efficiency with NAD(+) and a 4.5-fold increase in catalytic efficiency with NADP(+).
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
23% identity, 95% coverage: 10:354/362 of query aligns to 1:307/402 of 4pg7A
Sites not aligning to the query:
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
27% identity, 68% coverage: 110:356/362 of query aligns to 93:324/431 of 6dzsA
Sites not aligning to the query:
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 15, 45, 46, 47, 52, 63, 78, 79, 84
Query Sequence
>WP_057508710.1 NCBI__GCF_001431535.1:WP_057508710.1
MNAQVVELGHAAPRRLALLGTGTVGTAFVARYRALQSRGLALPRFDWLANSRAVLACDGA
PEQPLHALRRAPRLGDAAAPWKQADSLHAGDVVVDATASETVAAEHAHWLARGVHVVTAN
KLGQGAHAQRAVQIAAHCADSGARYGDSATVGAGLPLLSSLRALVEGGDRILRIEGVLSG
SLAWLFHRYDGSQPFSLAVREALDAGFTEPDPRLDLSGEDVRRKLLILARASGLDLADGQ
VQVDSLVPAALATLPHAQALEQLAQLDAPLHQRWLRAREAGQVLRFIGCVEAGAARVGVQ
SLAADHPLASGAGTDNRVAIHSDRYRDQPLLIQGPGAGAEVTAAALLDDVLRIARKETIE
RC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory