SitesBLAST
Comparing WP_057508721.1 NCBI__GCF_001431535.1:WP_057508721.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
47% identity, 95% coverage: 13:365/370 of query aligns to 9:352/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
47% identity, 95% coverage: 13:365/370 of query aligns to 10:351/360 of 3okfA
- active site: R120 (= R126), K142 (= K148), E184 (= E190), K226 (= K232), R238 (= R246), N242 (= N250), H245 (= H253), H249 (= H257), H262 (= H275)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D46), L48 (= L52), D71 (≠ A77), E73 (= E79), K76 (= K82), G104 (= G110), G105 (= G111), V106 (= V112), D109 (= D115), T129 (= T135), T130 (= T136), L132 (= L138), D136 (= D142), T172 (= T178), L173 (= L179), E177 (= E183)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
48% identity, 96% coverage: 7:361/370 of query aligns to 5:343/355 of 5eksA
- active site: R120 (= R126), K142 (= K148), E184 (= E190), K226 (= K232), R237 (= R246), N241 (= N250), H244 (= H253), H248 (= H257), H261 (= H275)
- binding magnesium ion: E184 (= E190), H244 (= H253), H261 (= H275)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D46), V45 (= V49), D71 (≠ A77), E73 (= E79), K76 (= K82), G104 (= G110), G105 (= G111), V106 (= V112), D109 (= D115), T129 (= T135), T130 (= T136), D136 (= D142), S137 (= S143), K142 (= K148), T172 (= T178), L173 (= L179), E177 (= E183)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
44% identity, 96% coverage: 13:369/370 of query aligns to 89:441/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
44% identity, 96% coverage: 13:369/370 of query aligns to 9:361/365 of 3zokA
- active site: R122 (= R126), K144 (= K148), E186 (= E190), K228 (= K232), E238 (= E242), R242 (= R246), N246 (= N250), H249 (= H253), H253 (= H257), H266 (= H275)
- binding glycine: K144 (= K148), K228 (= K232), R242 (= R246)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ E48), V45 (= V49), D73 (≠ A77), E75 (= E79), K78 (= K82), G106 (= G110), G107 (= G111), V108 (= V112), D111 (= D115), T131 (= T135), T132 (= T136), M134 (≠ L138), D138 (= D142), S139 (= S143), K144 (= K148), K153 (= K157), T174 (= T178), L175 (= L179), E179 (= E183), H266 (= H275)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
45% identity, 96% coverage: 14:369/370 of query aligns to 11:360/363 of 6llaB
- active site: R121 (= R126), K143 (= K148), E185 (= E190), K227 (= K232), E237 (= E242), R242 (= R246), N246 (= N250), H249 (= H253), H253 (= H257), H266 (= H275)
- binding magnesium ion: E185 (= E190), H249 (= H253), H266 (= H275)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V49), D72 (≠ A77), E74 (= E79), K77 (= K82), G105 (= G110), G106 (= G111), V107 (= V112), D110 (= D115), T130 (= T135), T131 (= T136), L133 (= L138), D137 (= D142), K143 (= K148), T173 (= T178), L174 (= L179), E178 (= E183)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
44% identity, 96% coverage: 14:369/370 of query aligns to 11:356/357 of 6lk2A
- active site: R121 (= R126), K143 (= K148), E185 (= E190), K227 (= K232), R238 (= R246), N242 (= N250), H245 (= H253), H249 (= H257), H262 (= H275)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D142), E185 (= E190), K227 (= K232), R238 (= R246), N242 (= N250), H245 (= H253), T246 (= T254), H249 (= H257), H262 (= H275)
- binding magnesium ion: E185 (= E190), H245 (= H253), H262 (= H275)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V49), D72 (≠ A77), E74 (= E79), K77 (= K82), G105 (= G110), G106 (= G111), V107 (= V112), D110 (= D115), T130 (= T135), T131 (= T136), L133 (= L138), D137 (= D142), S138 (= S143), C170 (≠ V175), T173 (= T178), L174 (= L179), P175 (= P180), E178 (= E183)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
42% identity, 91% coverage: 16:350/370 of query aligns to 14:339/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
41% identity, 91% coverage: 16:350/370 of query aligns to 17:334/354 of 5hvnA
- active site: R123 (= R126), K145 (= K148), E187 (= E190), K228 (= K232), R239 (= R246), N243 (= N250), H246 (= H253), H250 (= H257), H263 (= H275)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D46), L51 (= L52), D73 (≠ A77), E75 (= E79), K78 (= K82), G107 (= G110), G108 (= G111), V109 (= V112), D112 (= D115), T132 (= T135), T133 (= T136), L135 (= L138), D139 (= D142), K145 (= K148), F172 (≠ V175), T175 (= T178), L176 (= L179), E180 (= E183)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
37% identity, 88% coverage: 42:367/370 of query aligns to 30:339/343 of P56081
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
42% identity, 95% coverage: 1:351/370 of query aligns to 1:340/362 of P9WPX9
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
41% identity, 84% coverage: 42:352/370 of query aligns to 41:367/385 of 6c5cA
- active site: R130 (= R126), K152 (= K148), E194 (= E190), K246 (= K232), E254 (= E242), R258 (= R246), N262 (= N250), H265 (= H253), H269 (= H257), H281 (= H275)
- binding nicotinamide-adenine-dinucleotide: D45 (= D46), N47 (≠ E48), M48 (≠ V49), E83 (= E79), K86 (= K82), G114 (= G110), G115 (= G111), V116 (= V112), D119 (= D115), T139 (= T135), T140 (= T136), D146 (= D142), S147 (= S143), F179 (≠ V175), T182 (= T178), L183 (= L179), Q187 (≠ E183)
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
46% identity, 75% coverage: 75:351/370 of query aligns to 66:331/352 of 3qbeA
- active site: R117 (= R126), K139 (= K148), E181 (= E190), K223 (= K232), R233 (= R246), N237 (= N250), H240 (= H253), H244 (= H257), H256 (= H275)
- binding zinc ion: E181 (= E190), H240 (= H253), H256 (= H275)
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
37% identity, 92% coverage: 30:368/370 of query aligns to 26:385/1555 of 6hqvA
- active site: R123 (= R126), K145 (= K148), E187 (= E190), K243 (= K232), E253 (= E242), R257 (= R246), N261 (= N250), H264 (= H253), H268 (= H257), H280 (= H275)
- binding glutamic acid: D139 (= D142), K145 (= K148), E187 (= E190), K243 (= K232), R257 (= R246), H264 (= H253), H280 (= H275)
- binding nicotinamide-adenine-dinucleotide: D42 (= D46), N44 (≠ E48), L45 (≠ V49), E76 (= E79), K79 (= K82), G107 (= G110), G108 (= G111), V109 (= V112), D112 (= D115), T132 (= T135), T133 (= T136), L135 (= L138), D139 (= D142), S140 (= S143), K145 (= K148), K154 (= K157), T175 (= T178), L176 (= L179), P177 (= P180), E180 (= E183), H280 (= H275)
- binding zinc ion: E187 (= E190), H264 (= H253), H280 (= H275)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
39% identity, 87% coverage: 42:364/370 of query aligns to 37:381/381 of 1dqsA
- active site: R127 (= R126), K149 (= K148), E191 (= E190), K240 (= K232), E250 (= E242), R254 (= R246), N258 (= N250), H261 (= H253), H265 (= H257), H277 (= H275)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D142), K149 (= K148), N159 (= N158), E191 (= E190), K240 (= K232), R254 (= R246), L257 (= L249), N258 (= N250), H261 (= H253), H265 (= H257), H277 (= H275), K346 (= K334)
- binding nicotinamide-adenine-dinucleotide: D41 (= D46), N43 (≠ E48), I44 (≠ V49), E78 (= E79), K81 (= K82), G111 (= G110), G112 (= G111), V113 (= V112), D116 (= D115), T136 (= T135), T137 (= T136), L139 (= L138), D143 (= D142), S144 (= S143), K158 (= K157), T179 (= T178), P181 (= P180), E184 (= E183), H277 (= H275)
- binding zinc ion: E191 (= E190), H261 (= H253), H277 (= H275)
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
38% identity, 88% coverage: 42:365/370 of query aligns to 38:390/391 of 1nvbB
- active site: R128 (= R126), K150 (= K148), E192 (= E190), K248 (= K232), E258 (= E242), R262 (= R246), N266 (= N250), H269 (= H253), H273 (= H257), H285 (= H275)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D142), K150 (= K148), N160 (= N158), E192 (= E190), K248 (= K232), R262 (= R246), L265 (= L249), N266 (= N250), H269 (= H253), H273 (= H257), K354 (= K334)
- binding zinc ion: E192 (= E190), H269 (= H253), H285 (= H275)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
38% identity, 88% coverage: 42:365/370 of query aligns to 40:392/1583 of P07547
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
44% identity, 75% coverage: 75:351/370 of query aligns to 66:323/344 of 3qbdA
- active site: R117 (= R126), K139 (= K148), E181 (= E190), K223 (= K232), R232 (= R246), N236 (= N250), H239 (= H253), H243 (= H257), H255 (= H275)
- binding nicotinamide-adenine-dinucleotide: D68 (≠ A77), A69 (≠ G78), E70 (= E79), K73 (= K82), G101 (= G110), G102 (= G111), A103 (≠ V112), D106 (= D115), T126 (= T135), T127 (= T136), L129 (= L138), A134 (≠ S143), T169 (= T178), L170 (= L179)
Sites not aligning to the query:
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
37% identity, 75% coverage: 74:350/370 of query aligns to 63:330/353 of 1xagA
- active site: R115 (= R126), K136 (= K148), E178 (= E190), K221 (= K232), E231 (= E242), R235 (= R246), N239 (= N250), H242 (= H253), H246 (= H257), H256 (= H275)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K148), N146 (= N158), E178 (= E190), K221 (= K232), R235 (= R246), L238 (= L249), N239 (= N250), H242 (= H253), H246 (= H257), K314 (= K334)
- binding nicotinamide-adenine-dinucleotide: E68 (= E79), K71 (= K82), G99 (= G110), G100 (= G111), A101 (≠ V112), D104 (= D115), T124 (= T135), T125 (= T136), L127 (= L138), D130 (= D142), S131 (= S143), K136 (= K148), K145 (= K157), T166 (= T178), L167 (= L179), Q171 (≠ E183), H256 (= H275)
- binding zinc ion: E178 (= E190), H242 (= H253), H256 (= H275)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
37% identity, 75% coverage: 74:350/370 of query aligns to 63:330/354 of Q6GGU4
Sites not aligning to the query:
Query Sequence
>WP_057508721.1 NCBI__GCF_001431535.1:WP_057508721.1
MTDTPPLHVAVGGEHPYSITIGPGQLADGHALARHVRGRHVLLVSDSEVAPLYLAGVRAA
LLQARPDLLIGEHVLPAGEASKTLAEFGRAIEALAALGATRDACVLALGGGVVGDLSGFA
AACWMRGVDCVQLPTTLLAMVDSSVGGKTAVDIAAGKNLVGAFHPPRAVIADTQVLSTLP
VRELRAGLAEVVKYGALGDPEFFDWLQRHAQGLSAGDSALLAEAIARSCAHKAAIVARDP
LEKGERALLNLGHTFGHAIETEQGYAAPGRDALNHGEAVAVGMVLAARLSTALDRAPAAD
ADRLVALLQSLQLPVAIPAGLAPQALLERMRLDKKNVAGRLRLVLWRGIGKAEVVADVHD
EAVLAVLAAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory