Comparing WP_057508832.1 NCBI__GCF_001431535.1:WP_057508832.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
45% identity, 94% coverage: 8:405/425 of query aligns to 3:400/404 of 4cvqA
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
45% identity, 94% coverage: 8:405/425 of query aligns to 3:400/405 of P0A959
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
37% identity, 93% coverage: 13:407/425 of query aligns to 4:393/393 of 1xi9C
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 92% coverage: 15:405/425 of query aligns to 8:397/400 of Q02635
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
31% identity, 92% coverage: 15:405/425 of query aligns to 7:396/399 of 6f77A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 93% coverage: 11:404/425 of query aligns to 10:382/384 of 1o4sB
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 92% coverage: 14:406/425 of query aligns to 17:408/410 of P58350
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
30% identity, 92% coverage: 14:406/425 of query aligns to 7:398/400 of 6f35A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 89% coverage: 29:406/425 of query aligns to 22:384/385 of Q56232
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
31% identity, 88% coverage: 29:404/425 of query aligns to 22:382/382 of 1b5oA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 88% coverage: 29:404/425 of query aligns to 22:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 88% coverage: 29:404/425 of query aligns to 22:382/382 of 1bjwA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
31% identity, 88% coverage: 29:404/425 of query aligns to 22:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
31% identity, 88% coverage: 29:404/425 of query aligns to 22:382/382 of 1gc3A
Sites not aligning to the query:
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
28% identity, 91% coverage: 14:400/425 of query aligns to 11:467/479 of 3tcmA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 89% coverage: 28:407/425 of query aligns to 15:385/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 89% coverage: 28:407/425 of query aligns to 15:385/388 of 1gd9A
P17735 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Homo sapiens (Human) (see paper)
29% identity, 86% coverage: 38:402/425 of query aligns to 71:436/454 of P17735
3dydA Human tyrosine aminotransferase
29% identity, 86% coverage: 37:402/425 of query aligns to 14:380/388 of 3dydA
P04694 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 86% coverage: 37:400/425 of query aligns to 70:434/454 of P04694
Sites not aligning to the query:
>WP_057508832.1 NCBI__GCF_001431535.1:WP_057508832.1
MSTPTPKPLAIRERLSEVRYEIRGELARRARELEAQGRTLIKLNIGNPGNFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIAAAYARRGAPDAHPDRVFIGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPSEIEALVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIARKHNLLLMVDEIYDQILYDDAVFQPVAPLAGDQPCITF
SGLSKVHRACGWRVGWAMLSGDAGRLGEFRAAMDLLSALRLCANVPGQYAIDAAVNGPDT
ITPLCTPGGRLYETRRAVIDACAASEHLSLVAPAGALYAFPAVVGDAAKGLDDHDFALDL
MTDEGVLVVPGSSFNVPYRHHFRVTLLPEATVMREVFSRIDRALARRAEANRKVVPLKPR
RSAVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory