Comparing WP_057508837.1 NCBI__GCF_001431535.1:WP_057508837.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 51% coverage: 3:211/408 of query aligns to 44:268/583 of Q9Y7Q9
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
21% identity, 68% coverage: 9:285/408 of query aligns to 52:315/444 of Q8NLB7
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 39% coverage: 53:211/408 of query aligns to 108:277/572 of O42885
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 73% coverage: 30:327/408 of query aligns to 32:342/446 of A0A0H2VG78
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 35% coverage: 49:190/408 of query aligns to 186:313/616 of P36035
Sites not aligning to the query:
>WP_057508837.1 NCBI__GCF_001431535.1:WP_057508837.1
MWVAALSTVVEWYDFTLYLYFATVLSRVFFGGGETALLATLAGFAVSYLMRPLGALCFGH
LGDRLGRRWMLLASMALMAAAMLATALLPTYAQIGASAGVLLLALRCVMAFSVGGEYTGV
VAYLLESAPPRRRGLVTSLASAASEVGALLAVALSALTVALLPAPALDTWGWRIPFFVGA
GLALLILLARSGMHESPEFERQQREGSVPSAPIRQILRSHPGAVARTFAISALGSITYYV
GITYVPAFLHANGRGEGEALWLSTIAAVAVILATPLFGLLSDRFGRRPLLLGLTLLSALL
PLSMFGWMAQASTMGVIGAAVVLACVAGGISAVAASATAEQFPGEGRLSGLALGVTMATA
IFGGATPWLAQWWVERSGWNAAPGAMIAIVAVLVLPVLWRLPETRPLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory