SitesBLAST
Comparing WP_057508879.1 NCBI__GCF_001431535.1:WP_057508879.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gegA Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum (see paper)
40% identity, 92% coverage: 20:265/267 of query aligns to 4:230/241 of 3gegA
- active site: S132 (= S153), Y145 (= Y166), K149 (= K170)
- binding nicotinamide-adenine-dinucleotide: G8 (= G24), H11 (≠ N27), I13 (= I29), D32 (= D48), I33 (≠ L49), R37 (≠ A53), D54 (= D73), V55 (≠ I74), N81 (= N100), C83 (≠ A104), R84 (≠ D105), I130 (= I151), A131 (= A152), S132 (= S153), Y145 (= Y166), K149 (= K170), P174 (= P195), G175 (= G196), I177 (= I198), V179 (≠ T200)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 92% coverage: 15:260/267 of query aligns to 5:253/255 of 5itvA
- active site: G18 (= G28), S141 (= S153), Y154 (= Y166), K158 (= K170)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G24), S17 (≠ N27), G18 (= G28), I19 (= I29), D38 (= D48), I39 (≠ L49), T61 (≠ L72), I63 (= I74), N89 (= N100), G91 (= G102), T139 (≠ I151), S141 (= S153), Y154 (= Y166), K158 (= K170), P184 (= P195), G185 (= G196), I186 (≠ W197), I187 (= I198)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
40% identity, 92% coverage: 15:260/267 of query aligns to 3:249/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G24), G16 (= G28), I17 (= I29), D36 (= D48), L37 (= L49), C61 (≠ L72), D62 (= D73), V63 (≠ I74), N89 (= N100), A90 (= A101), T140 (≠ I151), S142 (= S153), Y155 (= Y166), K159 (= K170), A186 (≠ G196), V187 (≠ W197)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
33% identity, 94% coverage: 15:264/267 of query aligns to 8:255/258 of 4wecA
- active site: G21 (= G28), S143 (= S153), Q154 (≠ E164), Y157 (= Y166), K161 (= K170)
- binding nicotinamide-adenine-dinucleotide: G17 (= G24), A19 (= A26), S20 (≠ N27), G21 (= G28), I22 (= I29), D41 (= D48), I42 (≠ L49), V61 (≠ L72), D62 (= D73), V63 (≠ I74), N89 (= N100), T141 (≠ I151), Y157 (= Y166), K161 (= K170), P187 (= P195), P189 (≠ W197), V190 (≠ I198)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 92% coverage: 15:259/267 of query aligns to 5:255/258 of 3ak4A
- active site: G18 (= G28), S141 (= S153), L151 (≠ S163), Y154 (= Y166), K158 (= K170), E199 (≠ Q204)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ N27), G18 (= G28), I19 (= I29), D38 (= D48), L39 (= L49), V60 (≠ L72), D61 (= D73), V62 (≠ I74), N88 (= N100), A89 (= A101), G90 (= G102), T139 (≠ I151), S141 (= S153), Y154 (= Y166), K158 (= K170), G185 (= G196), V187 (≠ I198), T189 (= T200), M191 (≠ A202)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
40% identity, 92% coverage: 15:260/267 of query aligns to 3:237/240 of 2d1yA
- active site: G16 (= G28), S135 (= S153), N145 (≠ S163), Y148 (= Y166), K152 (= K170)
- binding nicotinamide-adenine-dinucleotide: G12 (= G24), R15 (≠ N27), I17 (= I29), D36 (= D48), L37 (= L49), R38 (≠ D50), V55 (≠ L72), D56 (= D73), L57 (≠ I74), N83 (= N100), A84 (= A101), A85 (≠ G102), I86 (= I103), V133 (≠ I151), S135 (= S153), Y148 (= Y166), K152 (= K170), P178 (= P195), G179 (= G196), I181 (= I198), T183 (= T200), A185 (= A202), V186 (vs. gap)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
34% identity, 92% coverage: 15:259/267 of query aligns to 5:242/245 of 5t5qC
- active site: G18 (= G28), S140 (= S153), N150 (≠ S163), Y153 (= Y166), K157 (= K170)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ A26), G17 (≠ N27), G18 (= G28), I19 (= I29), D38 (= D48), L39 (= L49), D63 (= D73), A64 (≠ I74), S90 (≠ N100), I113 (vs. gap), Y153 (= Y166), K157 (= K170), P182 (= P195), I185 (= I198), T187 (= T200), M189 (≠ A202)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 91% coverage: 15:258/267 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ N27) binding
- D36 (= D48) binding
- D62 (= D73) binding
- I63 (= I74) binding
- N89 (= N100) binding
- Y153 (= Y166) binding
- K157 (= K170) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 91% coverage: 15:258/267 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G24), M16 (≠ I29), D35 (= D48), I36 (≠ L49), I62 (= I74), N88 (= N100), G90 (= G102), I138 (= I151), S140 (= S153), Y152 (= Y166), K156 (= K170), I185 (= I198)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
36% identity, 96% coverage: 5:260/267 of query aligns to 2:255/257 of 5h5xC
- active site: G24 (= G28), S151 (= S153), Y164 (= Y166), K168 (= K170)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G24), S23 (≠ N27), G24 (= G28), I25 (= I29), D44 (= D48), F45 (≠ L49), L69 (= L72), D70 (= D73), N97 (= N100), A98 (= A101), Y164 (= Y166), K168 (= K170), P194 (= P195), G195 (= G196), I197 (= I198), T199 (= T200)
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
40% identity, 70% coverage: 73:260/267 of query aligns to 62:251/253 of 4ituA
- active site: N113 (≠ S125), S141 (= S153), Y154 (= Y166), K158 (= K170)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S153), Y154 (= Y166), T186 (≠ W197), R209 (≠ D218), Y213 (≠ H222)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D62 (= D73), V63 (≠ I74), N89 (= N100), V112 (vs. gap), F139 (≠ I151), S141 (= S153), Y154 (= Y166), K158 (= K170), P184 (= P195), T186 (≠ W197), V187 (≠ I198), T190 (= T200), M192 (≠ A202)
Sites not aligning to the query:
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
40% identity, 70% coverage: 73:260/267 of query aligns to 64:253/255 of A7IQH5
- DV 64:65 (≠ DI 73:74) binding
- N91 (= N100) binding
- S143 (= S153) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y166) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K170) binding ; mutation to A: Loss of activity.
- T188 (≠ W197) binding
- VTSTG 189:193 (≠ I-STG 198:201) binding
- R211 (≠ D218) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ Q221) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ H222) binding
Sites not aligning to the query:
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
37% identity, 91% coverage: 18:260/267 of query aligns to 2:250/253 of 4nbwA
- active site: G12 (= G28), S146 (= S153), Y159 (= Y166), K163 (= K170)
- binding nicotinamide-adenine-dinucleotide: G8 (= G24), N11 (= N27), G12 (= G28), I13 (= I29), D32 (= D48), L33 (= L49), V57 (≠ L72), D58 (= D73), V59 (≠ I74), N85 (= N100), A86 (= A101), G87 (= G102), S146 (= S153), Y159 (= Y166), K163 (= K170), I192 (= I198), T194 (= T200)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
36% identity, 91% coverage: 15:258/267 of query aligns to 4:236/244 of 1nfqA
- active site: G17 (= G28), S139 (= S153), Y152 (= Y166), K156 (= K170)
- binding Androsterone: L91 (≠ A104), E141 (≠ R155), C149 (≠ S163), Y152 (= Y166), V193 (≠ T211), I197 (≠ H219), F198 (≠ A220)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ N27), G17 (= G28), M18 (≠ I29), D37 (= D48), L39 (≠ D50), L59 (= L72), D60 (= D73), V61 (≠ I74), N87 (= N100), A88 (= A101), I137 (= I151), S139 (= S153), Y152 (= Y166), K156 (= K170), P182 (= P195), V185 (≠ I198), T187 (= T200), P188 (= P206), M189 (= M207), T190 (≠ R208)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
36% identity, 91% coverage: 15:258/267 of query aligns to 4:236/244 of 1nffA
- active site: G17 (= G28), S139 (= S153), Y152 (= Y166), K156 (= K170)
- binding nicotinamide-adenine-dinucleotide: G13 (= G24), R16 (≠ N27), G17 (= G28), M18 (≠ I29), D37 (= D48), I38 (≠ L49), L39 (≠ D50), L59 (= L72), D60 (= D73), V61 (≠ I74), N87 (= N100), A88 (= A101), G89 (= G102), I90 (= I103), I137 (= I151), S139 (= S153), Y152 (= Y166), K156 (= K170), P182 (= P195), V185 (≠ I198), T187 (= T200), P188 (= P206), M189 (= M207), T190 (≠ R208)
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
39% identity, 70% coverage: 73:260/267 of query aligns to 62:246/248 of 4gh5A
- active site: N113 (≠ S125), S141 (= S153), Y154 (= Y166), K158 (= K170)
- binding nicotinamide-adenine-dinucleotide: D62 (= D73), V63 (≠ I74), N89 (= N100), A90 (= A101), V112 (vs. gap), F139 (≠ I151), S141 (= S153), Y154 (= Y166), K158 (= K170), P184 (= P195), V187 (≠ I198), T190 (= T200), G191 (= G201), M192 (≠ A202)
Sites not aligning to the query:
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 95% coverage: 15:267/267 of query aligns to 5:246/260 of P9WGT1
- I6 (≠ A16) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ NGI 27:29) binding
- D38 (= D48) binding
- V47 (≠ C57) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DI 73:74) binding
- T69 (≠ R81) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N100) binding
- S140 (= S153) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y166) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K170) binding
- 183:191 (vs. 195:208, 36% identical) binding
6gtuA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fragment j6
38% identity, 84% coverage: 35:258/267 of query aligns to 24:245/268 of 6gtuA
- active site: S138 (= S153), Y151 (= Y166), K155 (= K170)
- binding N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine: N183 (≠ W197)
- binding nicotinamide-adenine-dinucleotide: D37 (= D48), K38 (≠ L49), D59 (= D73), N86 (= N100), A87 (= A101), G88 (= G102), L110 (= L126), S138 (= S153), Y151 (= Y166), K155 (= K170), G182 (= G196), I184 (= I198), T186 (= T200), L188 (≠ A202)
Sites not aligning to the query:
6emmA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid
38% identity, 84% coverage: 35:258/267 of query aligns to 24:245/268 of 6emmA
- active site: S138 (= S153), Y151 (= Y166), K155 (= K170)
- binding nicotinamide-adenine-dinucleotide: D37 (= D48), K38 (≠ L49), D59 (= D73), N86 (= N100), A87 (= A101), G88 (= G102), L110 (= L126), S138 (= S153), Y151 (= Y166), K155 (= K170), P181 (= P195), G182 (= G196), I184 (= I198), T186 (= T200), L188 (≠ A202)
Sites not aligning to the query:
6qckA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb262 (see paper)
38% identity, 84% coverage: 35:258/267 of query aligns to 24:245/258 of 6qckA
- active site: S138 (= S153), Y151 (= Y166), K155 (= K170)
- binding beta-D-glucopyranose: W185 (≠ S199), T186 (= T200), P187 (≠ G201), E190 (≠ Q204)
- binding 2-[2-(1,3-benzodioxol-2-yl)ethyl]benzoic acid: H90 (= H107), P93 (≠ A110), S138 (= S153), Q145 (≠ E160), Y151 (= Y166), L188 (≠ A202), W189 (= W203), L192 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: D37 (= D48), K38 (≠ L49), D59 (= D73), V60 (≠ I74), N86 (= N100), L110 (= L126), S138 (= S153), Y151 (= Y166), K155 (= K170), P181 (= P195), G182 (= G196), N183 (≠ W197), I184 (= I198), T186 (= T200), L188 (≠ A202)
Sites not aligning to the query:
Query Sequence
>WP_057508879.1 NCBI__GCF_001431535.1:WP_057508879.1
MSIVPAVAAWPAAPLAGKVVLVTGGANGIGRGIAQAVLGAGGQVMIGDLDVAAGKACLAE
WDRPADAAFRKLDITAEASVRGFIAAALKRFGRIDGLVNNAGIADAHGTALADMEWAQWQ
RRLSSLHGAFLCSKHALPALGADKRGAILNIASTRAQQSEPHSEAYAAAKGGLLAFTHAL
ALSAGPAVRVNSISPGWISTGAWQAPMRRRTPSLSRADHAQHPVGRVGQPEDIGALAVYL
LSDMAGFITGQDHIVDGGMTRKMIYVD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory