SitesBLAST
Comparing WP_057508923.1 NCBI__GCF_001431535.1:WP_057508923.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
60% identity, 99% coverage: 5:413/414 of query aligns to 3:410/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
60% identity, 98% coverage: 7:413/414 of query aligns to 1:406/406 of 1ybaA
- active site: N104 (= N110), R236 (= R242), D260 (= D266), E265 (= E271), H288 (= H294)
- binding 2-oxoglutaric acid: R56 (= R62), S57 (= S63), C79 (= C85), I80 (= I86)
- binding nicotinamide-adenine-dinucleotide: I80 (= I86), F102 (≠ Y108), V108 (= V114), G154 (= G160), G156 (= G162), H157 (= H163), I158 (= I164), Y176 (≠ H182), D177 (= D183), I178 (≠ V184), K181 (= K187), H206 (= H212), V207 (= V213), P208 (= P214), A234 (= A240), S235 (≠ A241), R236 (= R242), H288 (= H294), G290 (= G296)
- binding phosphate ion: G81 (= G87), N83 (= N89)
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
60% identity, 98% coverage: 10:413/414 of query aligns to 2:404/404 of 1psdA
- active site: N102 (= N110), R234 (= R242), D258 (= D266), E263 (= E271), H286 (= H294)
- binding nicotinamide-adenine-dinucleotide: N102 (= N110), H155 (= H163), I156 (= I164), D175 (= D183), I176 (≠ V184), K179 (= K187), H204 (= H212), V205 (= V213), P206 (= P214), A232 (= A240), S233 (≠ A241), R234 (= R242), H286 (= H294)
- binding serine: H338 (= H347), N340 (= N349), R341 (≠ V350), V344 (= V353)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
59% identity, 98% coverage: 7:413/414 of query aligns to 1:406/406 of 2p9eA
- active site: N104 (= N110), R236 (= R242), D260 (= D266), E265 (= E271), H288 (= H294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G162), H157 (= H163), I158 (= I164), Y176 (≠ H182), D177 (= D183), I178 (≠ V184), H206 (= H212), V207 (= V213), P208 (= P214), S212 (≠ A218), A234 (= A240), S235 (≠ A241), R236 (= R242), H288 (= H294), G290 (= G296)
1sc6D Crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with NAD+ (see paper)
56% identity, 98% coverage: 10:413/414 of query aligns to 2:384/384 of 1sc6D
- active site: N102 (= N110), R228 (= R242), D252 (= D266)
- binding nicotinamide-adenine-dinucleotide: P99 (= P107), F100 (≠ Y108), N102 (= N110), T103 (= T111), G146 (= G160), G148 (= G162), H149 (= H163), I150 (= I164), Y168 (≠ H182), D169 (= D183), I170 (≠ V184), H198 (= H212), V199 (= V213), P200 (= P214), S204 (≠ A218), T205 (= T219), S227 (≠ A241)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 100% coverage: 2:413/414 of query aligns to 43:466/466 of P87228
- S87 (≠ P45) modified: Phosphoserine
- S258 (≠ T216) modified: Phosphoserine
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 4:300/305 of 6plfA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 76% coverage: 14:327/414 of query aligns to 8:315/533 of O43175
- T78 (≠ I86) binding
- R135 (≠ K143) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ HI 163:164) binding
- D175 (= D183) binding
- T207 (≠ V213) binding
- CAR 234:236 (≠ AAR 240:242) binding
- D260 (= D266) binding
- V261 (= V267) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVGG 294:297) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 4:300/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ I86), A102 (≠ V114), G148 (= G160), R151 (≠ H163), I152 (= I164), Y170 (≠ H182), D171 (= D183), P172 (vs. gap), I173 (vs. gap), H202 (= H212), T203 (≠ V213), P204 (= P214), T209 (= T219), C230 (≠ A240), A231 (= A241), R232 (= R242), H279 (= H294), G281 (= G296)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ T24), K17 (≠ D27), I18 (≠ V28), E293 (≠ I308)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 3:299/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I159), G147 (= G160), L148 (≠ Y161), G149 (= G162), R150 (≠ H163), I151 (= I164), G152 (= G165), D170 (= D183), H201 (= H212), T202 (≠ V213), P203 (= P214)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 3:299/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 3:299/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 3:299/303 of 6plgA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 73% coverage: 14:315/414 of query aligns to 2:298/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N110), A100 (≠ V114), R149 (≠ H163), I150 (= I164), Y168 (≠ H182), D169 (= D183), P170 (vs. gap), I171 (vs. gap), H200 (= H212), T201 (≠ V213), P202 (= P214), T207 (= T219), C228 (≠ A240), A229 (= A241), R230 (= R242), H277 (= H294), G279 (= G296)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 73% coverage: 15:315/414 of query aligns to 1:296/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G162), I148 (= I164), Y166 (≠ H182), D167 (= D183), P168 (vs. gap), I169 (vs. gap), I170 (≠ V184), H198 (= H212), T199 (≠ V213), L208 (≠ M222), R228 (= R242)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 73% coverage: 14:314/414 of query aligns to 2:297/297 of 6rj3A
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
37% identity, 73% coverage: 13:316/414 of query aligns to 1:300/304 of 1wwkA
- active site: S96 (≠ N110), R230 (= R242), D254 (= D266), E259 (= E271), H278 (= H294)
- binding nicotinamide-adenine-dinucleotide: V100 (= V114), G146 (= G160), F147 (≠ Y161), G148 (= G162), R149 (≠ H163), I150 (= I164), Y168 (≠ H182), D169 (= D183), P170 (≠ V184), V201 (= V213), P202 (= P214), T207 (= T219), T228 (≠ A240), S229 (≠ A241), D254 (= D266), H278 (= H294), G280 (= G296)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 67% coverage: 36:311/414 of query aligns to 21:294/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
40% identity, 67% coverage: 36:311/414 of query aligns to 22:295/525 of 3ddnB
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 73% coverage: 14:315/414 of query aligns to 2:290/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ H163), Y160 (≠ H182), D161 (= D183), P162 (vs. gap), I164 (≠ V184), L179 (= L199), T193 (≠ V213), P194 (= P214), S198 (≠ A218), L202 (≠ M222)
Query Sequence
>WP_057508923.1 NCBI__GCF_001431535.1:WP_057508923.1
MSPKKTSYPKQDIRVLLLEGVSQTAVDVFTAAGYSQIELHSKALPEDELKARIADAHIVG
IRSRSQLSAEVLAEAKRVIAVGCFCIGTNQVDLDAAELAGIPVFNAPYSNTRSVAELVIA
EAIMLTRGIPQKNAECHRGGWSKSAAGSHEVRGKTLGIIGYGHIGTQVGVLAESLGLQVI
FHDVEAKLALGNARAAVSLDDLLERSDIITLHVPETPATQWMIGATELAKMRRGAHVINA
ARGTIVDIAALDAALGSGHIGGAALDVFPVEPKGNGDVFESPLTAHDNVILTPHVGGSTL
EAQDNIGIEVAAKLVRYSDNGSTLTAVNFPEVTLPEHDGSLRLLHIHRNVPGVLSKVNEI
FSRHNVNIDGQFLRTDAKVGYVVIDITASVEQAAAVRDELAAIPGTLRTRVLYS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory