SitesBLAST
Comparing WP_057508924.1 NCBI__GCF_001431535.1:WP_057508924.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
37% identity, 98% coverage: 6:459/462 of query aligns to 7:464/465 of 3pm9A
- active site: A149 (= A148), L159 (≠ N158)
- binding flavin-adenine dinucleotide: P69 (= P68), Q70 (≠ S69), G71 (= G70), G72 (= G71), N73 (≠ R72), T74 (= T73), G75 (= G74), L76 (= L75), G79 (= G78), Q80 (≠ A79), L91 (= L90), L133 (≠ F132), G134 (≠ A133), A135 (= A134), C139 (= C138), T140 (≠ S139), G142 (= G141), G143 (= G142), S146 (≠ A145), T147 (= T146), A149 (= A148), G150 (= G149), E200 (= E199), G201 (= G200), I205 (≠ V204), I206 (= I205), E423 (= E418)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
37% identity, 98% coverage: 6:460/462 of query aligns to 15:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W32), P76 (= P68), G78 (= G70), G79 (= G71), N80 (≠ R72), T81 (= T73), G82 (= G74), M83 (≠ L75), G86 (= G78), S87 (≠ A79), L140 (≠ F132), A142 (= A134), C146 (= C138), H147 (≠ S139), G150 (= G142), N151 (= N143), A153 (= A145), T154 (= T146), G208 (= G200), I212 (≠ V204), I213 (= I205), E423 (= E418), N460 (= N455)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
37% identity, 98% coverage: 6:460/462 of query aligns to 14:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R323), T337 (= T327), K348 (= K337), Y379 (≠ F370), H381 (= H372), H388 (= H379), H423 (= H419)
- binding flavin-adenine dinucleotide: W39 (= W32), P75 (= P68), Q76 (≠ S69), G77 (= G70), G78 (= G71), N79 (≠ R72), T80 (= T73), G81 (= G74), M82 (≠ L75), G85 (= G78), S86 (≠ A79), L139 (≠ F132), G140 (≠ A133), A141 (= A134), C145 (= C138), G149 (= G142), N150 (= N143), A152 (= A145), T153 (= T146), G157 (= G150), G207 (= G200), I212 (= I205), E422 (= E418), N459 (= N455)
- binding zinc ion: H381 (= H372), H388 (= H379), E422 (= E418)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
37% identity, 98% coverage: 6:460/462 of query aligns to 14:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W32), P75 (= P68), G77 (= G70), G78 (= G71), N79 (≠ R72), T80 (= T73), G81 (= G74), G85 (= G78), S86 (≠ A79), L139 (≠ F132), G140 (≠ A133), A141 (= A134), C145 (= C138), H146 (≠ S139), G148 (= G141), G149 (= G142), N150 (= N143), A152 (= A145), T153 (= T146), A155 (= A148), E206 (= E199), G207 (= G200), I211 (≠ V204), I212 (= I205), E422 (= E418), N459 (= N455)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R323), T337 (= T327), K348 (= K337), Y379 (≠ F370), H381 (= H372), H388 (= H379), H423 (= H419)
- binding zinc ion: H381 (= H372), H388 (= H379), E422 (= E418)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
37% identity, 98% coverage: 6:460/462 of query aligns to 14:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W32), P75 (= P68), G77 (= G70), G78 (= G71), N79 (≠ R72), T80 (= T73), G81 (= G74), G85 (= G78), S86 (≠ A79), L139 (≠ F132), G140 (≠ A133), A141 (= A134), C145 (= C138), H146 (≠ S139), G149 (= G142), N150 (= N143), A152 (= A145), T153 (= T146), A155 (= A148), G157 (= G150), E206 (= E199), G207 (= G200), I211 (≠ V204), I212 (= I205), E422 (= E418), N459 (= N455)
- binding d-malate: M82 (≠ L75), R333 (= R323), T337 (= T327), K348 (= K337), Y379 (≠ F370), H381 (= H372), H388 (= H379), E422 (= E418), H423 (= H419)
- binding zinc ion: H381 (= H372), H388 (= H379), E422 (= E418)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
37% identity, 98% coverage: 6:460/462 of query aligns to 14:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R323), T337 (= T327), K348 (= K337), Y379 (≠ F370), H381 (= H372), H388 (= H379), N390 (= N381), H423 (= H419)
- binding flavin-adenine dinucleotide: W39 (= W32), P75 (= P68), G77 (= G70), G78 (= G71), N79 (≠ R72), T80 (= T73), G81 (= G74), M82 (≠ L75), G85 (= G78), S86 (≠ A79), L139 (≠ F132), G140 (≠ A133), A141 (= A134), C145 (= C138), G149 (= G142), N150 (= N143), A152 (= A145), T153 (= T146), A155 (= A148), G157 (= G150), G207 (= G200), I212 (= I205), E422 (= E418), H423 (= H419)
- binding zinc ion: H381 (= H372), H388 (= H379), E422 (= E418)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
37% identity, 98% coverage: 6:460/462 of query aligns to 67:517/521 of Q8N465
- S109 (≠ V49) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V67) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G71) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V87) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M93) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ M112) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P129) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A145) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A171) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G173) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S312) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R323) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (= T327) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ K334) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K337) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ Q355) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ Y362) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H372) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G374) to V: slight reduction in catalytic activity
- N439 (= N377) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H379) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N381) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V382) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ G389) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E418) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H419) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G420) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 94% coverage: 24:458/462 of query aligns to 52:494/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 99% coverage: 6:462/462 of query aligns to 11:466/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P68), G75 (= G70), S76 (≠ G71), G77 (≠ R72), T78 (= T73), G79 (= G74), L80 (= L75), A83 (≠ G78), C84 (≠ A79), P137 (≠ F132), G138 (≠ A133), E139 (≠ A134), A142 (≠ C138), T143 (≠ S139), G146 (= G142), N147 (= N143), S149 (≠ A145), T150 (= T146), A152 (= A148), G153 (= G149), E203 (= E199), G204 (= G200), I209 (= I205), E422 (= E418), H423 (= H419)
- binding fe (iii) ion: H377 (= H372), H384 (= H379), E422 (= E418)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 98% coverage: 7:460/462 of query aligns to 6:456/459 of P9WIT1
- K354 (≠ A349) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W32), P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (≠ T327), E413 (= E418), H414 (= H419), N450 (= N455)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R323), H369 (= H372), H376 (= H379), H414 (= H419)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E418)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R323), W322 (≠ T327), H369 (= H372), H376 (= H379), H413 (= H419)
- binding flavin-adenine dinucleotide: E32 (≠ W32), P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (≠ T327), E412 (= E418), H413 (= H419), N449 (= N455)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E412 (= E418)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R323), W322 (≠ T327), S336 (≠ K337), H369 (= H372), H376 (= H379), H413 (= H419)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), E412 (= E418), N449 (= N455)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E412 (= E418)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 98% coverage: 6:460/462 of query aligns to 6:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R323), W322 (≠ T327), H369 (= H372), H376 (= H379), H414 (= H419)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (≠ T327), E413 (= E418), N450 (= N455)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E418)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 98% coverage: 6:460/462 of query aligns to 6:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (≠ T327), E413 (= E418), H414 (= H419), N450 (= N455)
- binding lactic acid: R318 (= R323), H369 (= H372), H376 (= H379), H414 (= H419)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E418)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W32), P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W323 (≠ T327), E414 (= E418), H415 (= H419), N451 (= N455)
- binding manganese (ii) ion: H370 (= H372), H377 (= H379), E414 (= E418)
- binding pyruvic acid: R319 (= R323), H370 (= H372), H377 (= H379), H415 (= H419)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 98% coverage: 6:460/462 of query aligns to 6:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L75), R317 (= R323), W321 (≠ T327), H368 (= H372), H375 (= H379), H413 (= H419)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W321 (≠ T327), Y322 (≠ E328), E412 (= E418), H413 (= H419), N449 (= N455)
- binding manganese (ii) ion: H368 (= H372), H375 (= H379), E412 (= E418)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R323), H369 (= H372), H376 (= H379), H414 (= H419)
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), W322 (≠ T327), E413 (= E418), H414 (= H419), N450 (= N455)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E418)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), H369 (= H372), E413 (= E418), N450 (= N455)
- binding deaminohydroxyvaline: R319 (= R323), H414 (= H419)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 98% coverage: 6:460/462 of query aligns to 6:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P68), G70 (= G70), T71 (≠ G71), G72 (≠ R72), T73 (= T73), G74 (= G74), G78 (= G78), V79 (≠ A79), L90 (= L90), P132 (≠ F132), G133 (≠ A133), A134 (= A134), G140 (= G142), M141 (≠ N143), A143 (= A145), T144 (= T146), A146 (= A148), S147 (≠ G149), E200 (= E199), G201 (= G200), I206 (= I205), Y324 (≠ E328), H370 (= H372), E414 (= E418), N451 (= N455)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R323), W323 (≠ T327), H415 (= H419)
Query Sequence
>WP_057508924.1 NCBI__GCF_001431535.1:WP_057508924.1
MTDPRVAALQQAVPDLRLKTDAADLEHYGRDWTRRWTPAPLAIALPASVDEVQAVMRWSA
AEGVAVVPSGGRTGLSGGAVAANGELVLSLERMNKALGYDAVDRTLVVQAGMPLEALHNA
ALEHGLIYPVDFAARGSCSIGGNIATNAGGIRVIRYGNTREWIAGLKVVTADGELLELNK
GLIKNSSGYDFRQLLIGSEGTLGVIVEATVKLTDPPPASNVMLLAVPSFEVLMQVFAAFR
ARLQLQAFEFFTAQALTHVLAHGAQAPFDEVHPFYVVTEFAAGDEAQEAAAMAAFEDCMG
NGWVSDGVISASDAQAAQLWRLREGITEAVARYKPYKNDVSVRISAMPAFLAETQALITQ
AYPQFEVVWFGHIGDGNLHINVLKPDDTGDAEFLQQCEQVTKLLAQVLARFDGSISAEHG
IGLVKKAYLDSTRGPAEIALMKAVKRAFDPQARLNPGKVFDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory