SitesBLAST
Comparing WP_057508989.1 NCBI__GCF_001431535.1:WP_057508989.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
62% identity, 99% coverage: 3:251/251 of query aligns to 4:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ N18), L22 (= L21), I42 (= I41), D65 (≠ N64), M66 (≠ L65), N92 (= N91), A93 (= A92), G94 (= G93), L115 (≠ V114), I143 (= I141), S145 (= S143), Y158 (= Y156), K162 (= K160), G189 (= G187), M191 (= M189), T193 (= T191), N195 (= N193)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
62% identity, 99% coverage: 3:251/251 of query aligns to 2:246/246 of 4hp8B
- active site: G19 (= G20), S138 (= S143), V148 (= V153), Y151 (= Y156), K155 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), N17 (= N18), T18 (= T19), G19 (= G20), L20 (= L21), R40 (≠ I41), R41 (≠ A42), D63 (≠ N64), F64 (≠ L65), N85 (= N91), G87 (= G93), I88 (≠ L94), I136 (= I141), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), I184 (≠ M189), T186 (= T191), N188 (= N193), T189 (= T194)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
50% identity, 98% coverage: 4:250/251 of query aligns to 2:248/249 of 3uf0A
- active site: G18 (= G20), S141 (= S143), V151 (= V153), Y154 (= Y156), K158 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (≠ T19), G18 (= G20), I19 (≠ L21), R39 (≠ I41), D63 (≠ N64), L64 (= L65), N89 (= N91), G91 (= G93), I92 (≠ L94), I139 (= I141), A140 (= A142), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), V187 (≠ M189), T189 (= T191), N191 (= N193), T192 (= T194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
41% identity, 98% coverage: 5:249/251 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S143), Q152 (≠ V153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ N18), R15 (≠ T19), G16 (= G20), I17 (≠ L21), N35 (≠ A39), Y36 (≠ G40), N37 (≠ I41), G38 (≠ A42), S39 (≠ P43), N63 (= N64), V64 (≠ L65), N90 (= N91), A91 (= A92), I93 (≠ L94), I113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ M189), T190 (= T191)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
40% identity, 98% coverage: 5:250/251 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G20), S143 (= S143), I154 (vs. gap), Y157 (= Y156), K161 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ T19), G17 (= G20), L18 (= L21), S37 (≠ G40), R38 (vs. gap), C63 (≠ A63), D64 (≠ N64), V65 (≠ L65), A91 (≠ N91), A92 (= A92), G93 (= G93), I94 (≠ L94), V114 (= V114), I141 (= I141), S143 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), G188 (= G187), Y190 (≠ M189), T192 (= T191), M194 (≠ N193), T195 (= T194)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
40% identity, 99% coverage: 3:250/251 of query aligns to 5:248/254 of 3o03A
- active site: G22 (= G20), S147 (= S143), V157 (= V153), Y160 (= Y156), K164 (= K160)
- binding calcium ion: S147 (= S143), M148 (= M144), P190 (= P186)
- binding D-gluconic acid: I99 (= I95), R101 (= R97), S147 (= S143), M149 (≠ L145), R154 (≠ G150), Y160 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ T19), G22 (= G20), I23 (≠ L21), D42 (≠ G40), I43 (= I41), L47 (vs. gap), D68 (≠ N64), V69 (≠ L65), N95 (= N91), A96 (= A92), G97 (= G93), I145 (= I141), Y160 (= Y156), K164 (= K160), P190 (= P186)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
40% identity, 98% coverage: 3:247/251 of query aligns to 10:256/261 of 5u9pB
- active site: G27 (= G20), S152 (= S143), Y165 (= Y156), K169 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G16), R26 (≠ T19), G27 (= G20), I28 (≠ L21), R48 (≠ D46), D73 (≠ E69), V74 (≠ P70), N100 (= N91), A101 (= A92), I150 (= I141), Y165 (= Y156), K169 (= K160), P195 (= P186), F198 (≠ M189), T200 (= T191), L202 (≠ N193), N203 (≠ T194)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 97% coverage: 5:248/251 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ N18), R18 (≠ T19), I20 (≠ L21), T40 (≠ P43), N62 (= N64), V63 (≠ L65), N89 (= N91), A90 (= A92), I92 (≠ L94), V139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I187 (≠ M189), T189 (= T191), M191 (≠ N193)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 95% coverage: 10:248/251 of query aligns to 5:244/246 of 3osuA
2ekpA Structure of tt0495 protein from thermus thermophilus (see paper)
37% identity, 96% coverage: 10:250/251 of query aligns to 2:237/238 of 2ekpA
- active site: G12 (= G20), S128 (= S143), Y143 (= Y156), K147 (= K160)
- binding nicotinamide-adenine-dinucleotide: G8 (= G16), S10 (≠ N18), G12 (= G20), I13 (≠ L21), S32 (≠ G40), T49 (≠ A63), D50 (≠ N64), L51 (= L65), A76 (≠ N91), A78 (≠ G93), I126 (= I141), G127 (≠ A142), Y143 (= Y156), K147 (= K160), P173 (= P186), G174 (= G187), V176 (≠ M189), T178 (= T191), F180 (≠ N193), T181 (= T194)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 95% coverage: 10:248/251 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G20), S138 (= S143), Q148 (≠ V153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ N18), R11 (≠ T19), I13 (≠ L21), N31 (vs. gap), Y32 (vs. gap), A33 (= A39), G34 (= G40), S35 (≠ I41), A58 (= A63), N59 (= N64), V60 (≠ L65), N86 (= N91), A87 (= A92), T109 (≠ V114), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
37% identity, 97% coverage: 5:248/251 of query aligns to 4:240/243 of 4i08A
- active site: G19 (= G20), N113 (= N115), S141 (= S143), Q151 (≠ V153), Y154 (= Y156), K158 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ N18), R18 (≠ T19), I20 (≠ L21), T40 (≠ P43), N62 (= N64), V63 (≠ L65), N89 (= N91), A90 (= A92), G140 (≠ A142), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), T189 (= T191)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
37% identity, 98% coverage: 7:251/251 of query aligns to 2:260/260 of 5b4tA
- active site: G15 (= G20), N114 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160), I200 (vs. gap)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ I95), S142 (= S143), H144 (≠ L145), K152 (≠ V153), Y155 (= Y156), W187 (≠ Y188), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (≠ N18), G15 (= G20), I16 (≠ L21), F36 (≠ I41), D63 (≠ N64), L64 (= L65), N90 (= N91), G92 (= G93), L113 (≠ V114), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), W187 (≠ Y188), V188 (≠ M189), T190 (= T191), L192 (vs. gap), V193 (vs. gap)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
37% identity, 98% coverage: 7:251/251 of query aligns to 2:260/260 of 3w8dA
- active site: G15 (= G20), N114 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160), I200 (vs. gap)
- binding methylmalonic acid: Q94 (≠ I95), S142 (= S143), H144 (≠ L145), K152 (≠ V153), Y155 (= Y156), W187 (≠ Y188), Q196 (vs. gap), W257 (= W248)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (≠ N18), S14 (≠ T19), G15 (= G20), I16 (≠ L21), F36 (≠ I41), A62 (= A63), D63 (≠ N64), L64 (= L65), N90 (= N91), A91 (= A92), G92 (= G93), L113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), W187 (≠ Y188), V188 (≠ M189), T190 (= T191), L192 (vs. gap), V193 (vs. gap)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
37% identity, 98% coverage: 7:251/251 of query aligns to 2:260/260 of 3vdrA
- active site: G15 (= G20), N114 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160), I200 (vs. gap)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ I95), H144 (≠ L145), K152 (≠ V153), Y155 (= Y156), W187 (≠ Y188), Q196 (vs. gap), W257 (= W248)
- binding acetoacetic acid: Q94 (≠ I95), H144 (≠ L145), K152 (≠ V153), Y155 (= Y156), W187 (≠ Y188), Q196 (vs. gap), W257 (= W248)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (≠ N18), I16 (≠ L21), F36 (≠ I41), D63 (≠ N64), L64 (= L65), N90 (= N91), A91 (= A92), G92 (= G93), L113 (≠ V114), K159 (= K160), G186 (= G187), V188 (≠ M189), T190 (= T191), L192 (vs. gap), V193 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), T13 (≠ N18), I16 (≠ L21), F36 (≠ I41), D63 (≠ N64), L64 (= L65), N90 (= N91), A91 (= A92), G92 (= G93), L113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), G186 (= G187), V188 (≠ M189), T190 (= T191), L192 (vs. gap), V193 (vs. gap)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
37% identity, 98% coverage: 7:251/251 of query aligns to 2:260/260 of 3vdqA
- active site: G15 (= G20), N114 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160), I200 (vs. gap)
- binding acetate ion: Q94 (≠ I95), H144 (≠ L145), K152 (≠ V153), W187 (≠ Y188), L192 (vs. gap), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), S14 (≠ T19), I16 (≠ L21), F36 (≠ I41), D63 (≠ N64), L64 (= L65), N90 (= N91), A91 (= A92), G92 (= G93), L113 (≠ V114), I140 (= I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), W187 (≠ Y188), V188 (≠ M189), T190 (= T191), L192 (vs. gap), V193 (vs. gap)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
39% identity, 98% coverage: 7:251/251 of query aligns to 2:260/260 of 2ztlA
- active site: G15 (= G20), N114 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160), L200 (≠ D200)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ I95), S142 (= S143), H144 (≠ L145), K152 (≠ V153), Y155 (= Y156), Q196 (≠ A196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G15 (= G20), I16 (≠ L21), F36 (≠ I41), L64 (= L65), N90 (= N91), A91 (= A92), G92 (= G93), L113 (≠ V114), Y155 (= Y156), K159 (= K160), P185 (= P186), W187 (≠ Y188), V188 (≠ M189), T190 (= T191), V193 (≠ T194)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
39% identity, 98% coverage: 7:251/251 of query aligns to 2:260/260 of 1wmbA
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
37% identity, 97% coverage: 6:249/251 of query aligns to 3:245/247 of P73574
- A14 (≠ G17) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ V151) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K160) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y188) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R198) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
39% identity, 98% coverage: 7:251/251 of query aligns to 2:236/236 of 1x1tA
- active site: G15 (= G20), N114 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding cacodylate ion: S142 (= S143), H144 (≠ L145), Y155 (= Y156), W187 (≠ Y188), W233 (= W248)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (≠ N18), S14 (≠ T19), G15 (= G20), I16 (≠ L21), G35 (= G40), F36 (≠ I41), D63 (≠ N64), L64 (= L65), N90 (= N91), G92 (= G93), L113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), W187 (≠ Y188), V188 (≠ M189), T190 (= T191)
Query Sequence
>WP_057508989.1 NCBI__GCF_001431535.1:WP_057508989.1
MANPFSLEGKVALVTGGNTGLGQGIAVALAAAGADVAVAGIAPPTDTVAKITGLGRRCLA
IEANLVSIEPVERVVRETIEGLGGLDILVNNAGLIRRADAVDFTEQDWDDVMNVNIKSAF
FISQAAGRHFIAQGHGKIINIASMLSFQGGVRVPSYTASKSGIAGITRLLANEWAGKGIN
VNAIAPGYMATDNTAALRADADRNKSILERIPAARWGNPEDLAGAAVFLASSASDYVNGA
VLPVDGGWLAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory