Comparing WP_057509040.1 NCBI__GCF_001431535.1:WP_057509040.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
45% identity, 88% coverage: 38:331/333 of query aligns to 5:299/300 of 4n8yA
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
43% identity, 88% coverage: 38:330/333 of query aligns to 5:296/298 of 4ovrA
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
40% identity, 88% coverage: 38:331/333 of query aligns to 5:298/301 of 4mhfA
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
40% identity, 88% coverage: 38:331/333 of query aligns to 35:328/330 of Q128M1
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
40% identity, 88% coverage: 38:331/333 of query aligns to 5:298/302 of 4mijA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
38% identity, 89% coverage: 36:331/333 of query aligns to 6:302/304 of 4x8rA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
35% identity, 88% coverage: 40:331/333 of query aligns to 6:299/300 of 4pf8A
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
34% identity, 88% coverage: 40:331/333 of query aligns to 7:300/303 of 4p3lA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
34% identity, 90% coverage: 31:329/333 of query aligns to 24:324/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
34% identity, 89% coverage: 35:330/333 of query aligns to 2:299/301 of 4n17A
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
34% identity, 89% coverage: 35:330/333 of query aligns to 2:299/301 of 4n15A
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
33% identity, 87% coverage: 40:330/333 of query aligns to 7:299/302 of 4ovqA
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
36% identity, 85% coverage: 34:316/333 of query aligns to 2:286/301 of 4x04A
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
34% identity, 87% coverage: 40:329/333 of query aligns to 7:295/306 of 4xfeA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
31% identity, 84% coverage: 51:331/333 of query aligns to 19:299/301 of 4pdhA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
30% identity, 83% coverage: 51:325/333 of query aligns to 22:297/304 of 4pakA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
30% identity, 83% coverage: 51:325/333 of query aligns to 21:296/303 of 4p9kA
Sites not aligning to the query:
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
30% identity, 83% coverage: 57:331/333 of query aligns to 25:298/301 of 4nq8B
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 78% coverage: 59:319/333 of query aligns to 27:288/303 of 4pddA
Sites not aligning to the query:
4n91A Crystal structure of a trap periplasmic solute binding protein from anaerococcus prevotii dsm 20548 (apre_1383), target efi-510023, with bound alpha/beta d-glucuronate (see paper)
27% identity, 83% coverage: 45:319/333 of query aligns to 13:288/308 of 4n91A
Sites not aligning to the query:
>WP_057509040.1 NCBI__GCF_001431535.1:WP_057509040.1
MITRRNFLATSLGALAAPALIGCSKAGDSVAGGHLLTATDVHVADYPTVTAVKWIGQTLE
RETGGRLRLRQYHSGQLGRESEAIDMARFGAIDITRVYSGALNNAFPLTQALCLPYVFDS
VAHMRAALDGGVADAVLRGFESRDLVGLAIYDSGARCFYNTKHPIVAPQDLRGLKLRVAS
SDIFIQLMRLFGANPTPMSLGDTFSGMETHMIDGAENNMRSFHSSRHFEAAHYWSQSDHS
YAPDVLLMSRASYDQLRPDDRQLLLETARASVKVMREQWDASEDAARKAVVDFGVKTNEV
DLVAFRKAADPLLQEYLKQPELAAMVSRIRDLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory